Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Topoisomerase I (sub omega)

Protein FULL name:

unnamed protein product [Escherichia coli].


Topoisomerase I (sub omega) (Escherichia coli strain K-12 substr. MG1655) is product of expression of topA gene.






FUNCTION: The reaction catalyzed by topoisomerases leads to the conversion of one topological isomer of DNA to another.

CATALYTIC ACTIVITY: ATP-independent breakage of single-stranded DNA, followed by passage and rejoining.

SUBUNIT: Monomer.

INTERACTION: P27862:yigZ; NbExp=1; IntAct=EBI-544172, EBI-561235;

MISCELLANEOUS: When a topoisomerase transiently breaks a DNA backbone bond, it simultaneously forms a protein-DNA link, in which a tyrosyl oxygen in the enzyme is joined to a DNA phosphorus at one end of the enzyme-severed DNA strand.

SIMILARITY: Belongs to the prokaryotic type I/III topoisomerase family.

SIMILARITY: Contains 1 Toprim domain.


NCBI GenPept GI number(s): 415338
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P06612 P06612
PFAM: - P06612 (Link - using uniprot id)
InterPro: IPR000380
IPR003601
IPR003602
IPR005733
IPR006154
IPR006171
IPR013263
IPR013497
IPR013498
IPR013824
IPR000380
IPR003601
IPR003602
IPR005733
IPR006154
IPR006171
IPR013263
IPR013497
IPR013498
IPR013824
CATH: - -
SCOP: - -
PDB: 1CY0 1CY1 1CY2 1CY4 1CY6 1CY7 1CY8 1CY9 1CYY 1ECL 1MW8 1MW9 1YUA 1CY0
1CY1
1CY2
1CY4
1CY6
1CY7
1CY8
1CY9
1CYY
1ECL
1MW8
1MW9
1YUA


Protein sequence:
MGKALVIVESPAKAKTINKYLGSDYVVKSSVGHIRDLPTSGSAAKKSADS
TSTKTAKKPKKDERGALVNRMGVDPWHNWEAHYEVLPGKEKVVSELKQLA
EKADHIYLATDLDREGEAIAWHLREVIGGDDARYSRVVFNEITKNAIRQA
FNKPGELNIDRVNAQQARRFMDRVVGYMVSPLLWKKIARGLSAGRVQSVA
VRLVVEREREIKAFVPEEFWEVDASTTTPSGEALALQVTHQNDKPFRPVN
KEQTQAAVSLLEKARYSVLEREDKPTTSKPGAPFITSTLQQAASTRLGFG
VKKTMMMAQRLYEAGYITYMRTDSTNLSQDAVNMVRGYISDNFGKKYLPE
SPNQYASKENSQEAHEAIRPSDVNVMAESLKDMEADAQKLYQLIWRQFVA
CQMTPAKYDSTTLTVGAGDFRLKARGRILRFDGWTKVMPALRKGDEDRIL
PAVNKGDALTLVELTPAQHFTKPPARFSEASLVKELEKRGIGRPSTYASI
ISTIQDRGYVRVENRRFYAEKMGEIVTDRLEENFRELMNYDFTAQMENSL
DQVANHEAEWKAVLDHFFSDFTQQLDKAEKDPEEGGMRPNQMVLTSIDCP
TCGRKMGIRTASTGVFLGCSGYALPPKERCKTTINLVPENEVLNVLEGED
AETNALRAKRRCPKCGTAMDSYLIDPKRKLHVCGNNPTCDGYEIEEGEFR
IKGYDGPIVECEKCGSEMHLKMGRFGKYMACTNEECKNTRKILRNGEVAP
PKEDPVPLPELPCEKSDAYFVLRDGAAGVFLAANTFPKSRETRAPLVEEL
YRFRDRLPEKLRYLADAPQQDPEGNKTMVRFSRKTKQQYVSSEKDGKATG
WSAFYVDGKWVEGKK

Topoisomerase I (sub omega) (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
Solved crystal structures:
References:

Title Authors Journal
Complete nucleotide sequence of the topA gene encoding Escherichia coli DNA topoisomerase I. Tse-Dinh YC, Wang JC J Mol Biol Oct. 5, 1986
DNA sequences of the cysB regions of Salmonella typhimurium and Escherichia coli. Ostrowski J, Jagura-Burdzy G, Kredich NM J Biol Chem May 5, 1987
Three-dimensional structure of the 67K N-terminal fragment of E. coli DNA topoisomerase I. Lima CD, Wang JC, Mondragon A Nature Feb. 13, 1994
Solution structure of the C-terminal single-stranded DNA-binding domain of Escherichia coli topoisomerase I. Yu L, Zhu CX, Tse-Dinh YC, Fesik SW Biochemistry June 13, 1995
A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al. DNA Res Dec. 31, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.