Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ung

Protein FULL name:

uracil DNA glycosylase [Escherichia coli].


Ung (Escherichia coli strain K-12 substr. MG1655) is product of expression of ung gene.


Ung is involved in:

BER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

CATALYTIC ACTIVITY: Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.

SUBUNIT: Monomer.

INTERACTION: P08957:hsdM; NbExp=1; IntAct=EBI-559403, EBI-878571; P0A763:ndk; NbExp=3; IntAct=EBI-559403, EBI-370139;

SUBCELLULAR LOCATION: Cytoplasm.

SIMILARITY: Belongs to the uracil-DNA glycosylase family.


NCBI GenPept GI number(s): 148149
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P12295 P12295
PFAM: - P12295 (Link - using uniprot id)
InterPro: - P12295 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MANELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRF
TELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTI
PGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVIS
LINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGC
NHFVLANQWLEQRGETPIDWMPVLPAESE

Ung (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:

Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.