Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rev3p

Protein FULL name:

Catalytic subunit of DNA polymerase zeta, involved in translesion synthesis during post-replication repair; required for mutagenesis induced by DNA damage; involved in double-strand break repair


Rev3p (Saccharomyces cerevisiae) is product of expression of REV3 gene.


Rev3p is involved in:

TLS in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: Nonessential DNA polymerase. Required for DNA damage induced mutagenesis. Involved in DNA repair, mitochondrial DNA repair and translesion synthesis. Translesion synthesis in S.cerevisiae may use a specialized DNA polymerase that is not required for other DNA replicative processes. Has a role in the bypass of abasic (AP) sites. Highly inefficient in incorporating nucleotides opposite the AP site, but efficiently extends from nucleotides, particularly an A, inserted opposite the lesion.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=543 uM for dGTP (insertion opposite abasic site); KM=81 uM for dATP (insertion opposite abasic site); KM=125 uM for dTTP (insertion opposite abasic site); KM=113 uM for dCTP (insertion opposite abasic site); KM=0.11 uM for dGTP (insertion opposite C); KM=267 uM for dATP (insertion opposite C); KM=552 uM for dTTP (insertion opposite C); KM=321 uM for dCTP (insertion opposite C); KM=344 uM for dGTP (insertion opposite G); KM=118 uM for dATP (insertion opposite G); KM=428 uM for dTTP (insertion opposite G); KM=0.14 uM for dCTP (insertion opposite G); KM=6.5 uM for dTTP (extension from G, A, T, or C opposite abasic site); KM=2.3 uM for dTTP (extension from G, A, T, or C opposite abasic site); KM=49 uM for dTTP (extension from G, A, T, or C opposite abasic site); KM=21 uM for dTTP (extension from G, A, T, or C opposite abasic site); KM=0.35 uM for dTTP (extension from G, A, T, or C opposite C); KM=2.3 uM for dTTP (extension from G, A, T, or C opposite C); KM=15 uM for dTTP (extension from G, A, T, or C opposite C); KM=26 uM for dTTP (extension from G, A, T, or C opposite C); KM=6.9 uM for dTTP (extension from G, A, T, or C opposite G); KM=2.1 uM for dTTP (extension from G, A, T, or C opposite G); KM=28.8 uM for dTTP (extension from G, A, T, or C opposite G); KM=0.23 uM for dTTP (extension from G, A, T, or C opposite G);

SUBUNIT: Forms DNA polymerase zeta with REV7.

INTERACTION: P38927:REV7; NbExp=1; IntAct=EBI-6155, EBI-14960;

SUBCELLULAR LOCATION: Mitochondrion. Nucleus (Potential).

SIMILARITY: Belongs to the DNA polymerase type-B family.


NCBI GenPept GI number(s): 6325090
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P14284 P14284
PFAM: - P14284 (Link - using uniprot id)
InterPro: - P14284 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSRESNDTIQSDTVRSSSKSDYFRIQLNNQDYYMSKPTFLDPSHGESLPL
NQFSQVPNIRVFGALPTGHQVLCHVHGILPYMFIKYDGQITDTSTLRHQR
CAQVHKTLEVKIRASFKRKKDDKHDLAGDKLGNLNFVADVSVVKGIPFYG
YHVGWNLFYKISLLNPSCLSRISELIRDGKIFGKKFEIYESHIPYLLQWT
ADFNLFGCSWINVDRCYFRSPVLNSILDIDKLTINDDLQLLLDRFCDFKC
NVLSRRDFPRVGNGLIEIDILPQFIKNREKLQHRDIHHDFLEKLGDISDI
PVKPYVSSARDMINELTMQREELSLKEYKEPPETKRHVSGHQWQSSGEFE
AFYKKAQHKTSTFDGQIPNFENFIDKNQKFSAINTPYEALPQLWPRLPQI
EINNNSMQDKKNDDQVNASFTEYEICGVDNENEGVKGSNIKSRSYSWLPE
SIASPKDSTILLDHQTKYHNTINFSMDCAMTQNMASKRKLRSSVSANKTS
LLSRKRKKVMAAGLRYGKRAFVYGEPPFGYQDILNKLEDEGFPKIDYKDP
FFSNPVDLENKPYAYAGKRFEISSTHVSTRIPVQFGGETVSVYNKPTFDM
FSSWKYALKPPTYDAVQKWYNKVPSMGNKKTESQISMHTPHSKFLYKFAS
DVSGKQKRKKSSVHDSLTHLTLEIHANTRSDKIPDPAIDEVSMIIWCLEE
ETFPLDLDIAYEGIMIVHKASEDSTFPTKIQHCINEIPVMFYESEFEMFE
ALTDLVLLLDPDILSGFEIHNFSWGYIIERCQKIHQFDIVRELARVKCQI
KTKLSDTWGYAHSSGIMITGRHMINIWRALRSDVNLTQYTIESAAFNILH
KRLPHFSFESLTNMWNAKKSTTELKTVLNYWLSRAQINIQLLRKQDYIAR
NIEQARLIGIDFHSVYYRGSQFKVESFLIRICKSESFILLSPGKKDVRKQ
KALECVPLVMEPESAFYKSPLIVLDFQSLYPSIMIGYNYCYSTMIGRVRE
INLTENNLGVSKFSLPRNILALLKNDVTIAPNGVVYAKTSVRKSTLSKML
TDILDVRVMIKKTMNEIGDDNTTLKRLLNNKQLALKLLANVTYGYTSASF
SGRMPCSDLADSIVQTGRETLEKAIDIIEKDETWNAKVVYGDTDSLFVYL
PGKTAIEAFSIGHAMAERVTQNNPKPIFLKFEKVYHPSILISKKRYVGFS
YESPSQTLPIFDAKGIETVRRDGIPAQQKIIEKCIRLLFQTKDLSKIKKY
LQNEFFKIQIGKVSAQDFCFAKEVKLGAYKSEKTAPAGAVVVKRRINEDH
RAEPQYKERIPYLVVKGKQGQLLRERCVSPEEFLEGENLELDSEYYINKI
LIPPLDRLFNLIGINVGNWAQEIVKSKRASTTTTKVENITRVGTSATCCN
CGEELTKICSLQLCDDCLEKRSTTTLSFLIKKLKRQKEYQTLKTVCRTCS
YRYTSDAGIENDHIASKCNSYDCPVFYSRVKAERYLRDNQSVQREEALIS
LNDW

Rev3p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
REV3, a Saccharomyces cerevisiae gene whose function is required for induced mutagenesis, is predicted to encode a nonessential DNA polymerase. Morrison A, Christensen RB, Alley J, Beck AK, Bernstine EG, Lemontt JF, Lawrence CW J Bacteriol Oct. 1, 1989
Thymine-thymine dimer bypass by yeast DNA polymerase zeta. Nelson JR, Lawrence CW, Hinkle DC Science June 14, 1996
The sequence of 55 kb on the left arm of yeast chromosome XVI identifies a small nuclear RNA, a new putative protein kinase and two new putative regulators. Purnelle B, Coster F, Goffeau A Yeast Nov. 1, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature May 1, 1997
Roles of yeast DNA polymerases delta and zeta and of Rev1 in the bypass of abasic sites. Haracska L, Unk I, Johnson RE, Johansson E, Burgers PM, Prakash S, Prakash L Genes Dev April 15, 2001
Saccharomyces cerevisiae polymerase zeta functions in mitochondria. Zhang H, Chatterjee A, Singh KK Genetics April 1, 2006


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.