Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Spo11p

Protein FULL name:

Meiosis-specific protein that initiates meiotic recombination by catalyzing the formation of double-strand breaks in DNA via a transesterification reaction; required for homologous chromosome pairing and synaptonemal complex formation


Spo11p (Saccharomyces cerevisiae) is product of expression of SPO11 gene.



Keywords:



FUNCTION: Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination. The action of SPO11 is important in setting off a regulatory chain of events encompassing 5' to 3' resection. When there are no SPO11-DSBs, resection of a site specific VDE-DSB takes place but it is faster than in wild-type meiosis and increases the risk of uncovering flanking homology.

SUBCELLULAR LOCATION: Nucleus.

DEVELOPMENTAL STAGE: Meiosis-specific.

SIMILARITY: Belongs to the TOP6A family.


NCBI GenPept GI number(s): 6321765
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P23179 P23179
PFAM: - P23179 (Link - using uniprot id)
InterPro: - P23179 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MALEGLRKKYKTRQELVKALTPKRRSIHLNSNGHSNGTPCSNADVLAHIK
HFLSLAANSLEQHQQPISIVFQNKKKKGDTSSPDIHTTLDFPLNGPHLCT
HQFKLKRCAILLNLLKVVMEKLPLGKNTTVRDIFYSNVELFQRQANVVQW
LDVIRFNFKLSPRKSLNIIPAQKGLVYSPFPIDIYDNILTCENEPKMQKQ
TIFPGKPCLIPFFQDDAVIKLGTTSMCNIVIVEKEAVFTKLVNNYHKLST
NTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNY
THSNERNAYICTMANYKGIRITQVLAQNNEVHNKSIQLLSLNQRDYSLAK
NLIASLTANSWDIATSPLKNVIIECQREIFFQKKAEMNEIDARIFEYK

Spo11p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Isolation, DNA sequence, and regulation of a meiosis-specific eukaryotic recombination gene. Atcheson CL, DiDomenico B, Frackman S, Esposito RE, Elder RT Proc Natl Acad Sci U S A Nov. 1, 1987
Large-scale analysis of gene expression, protein localization, and gene disruption in Saccharomyces cerevisiae. Burns N, Grimwade B, Ross-Macdonald PB, Choi EY, Finberg K, Roeder GS, Snyder M Genes Dev May 1, 1994
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII. Johnston M, Andrews S, Brinkman R, Cooper J, Ding H, Dover J, Du Z, Favello A, Fulton L, Gattung S, et al. Science Sept. 1, 1994
An atypical topoisomerase II from Archaea with implications for meiotic recombination. Bergerat A, de Massy B, Gadelle D, Varoutas PC, Nicolas A, Forterre P Nature March 27, 1997
Wild-type levels of Spo11-induced DSBs are required for normal single-strand resection during meiosis. Neale MJ, Ramachandran M, Trelles-Sticken E, Scherthan H, Goldman AS Mol Cell April 1, 2002
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res April 1, 2007


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.