Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
POLD1 |
Protein FULL name:
DNA polymerase delta catalytic subunit, DNA polymerase subunit delta p125
POLD1 (Homo sapiens) is product of expression of POLD1 gene.
POLD1 is involved in:
NER in Homo sapiens BER in Homo sapiens
Keywords:
- mismatch repair (MMR)
- transcription-coupled repair NER (TCR-NER)
- nucleotide excision repair (NER)
- base excision repair (BER)
- long path BER (LP-BER)
- global genome repair NER (GGR-NER)
- DNA polymerase
FUNCTION: Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
SUBUNIT: Heterotetramer composed of subunits of 125 kDa, 50 kDa, 66 kDa and 12 kDa. The 125 kDa subunit contains the polymerase active site and most likely the active site for the 3'-5' exonuclease activity. Interacts with WRNIP1. Interacts with POLD4 and PCNA.
INTERACTION: P00519:ABL1; NbExp=1; IntAct=EBI-716569, EBI-375543; P06241:FYN; NbExp=1; IntAct=EBI-716569, EBI-515315; P62993:GRB2; NbExp=1; IntAct=EBI-716569, EBI-401755; P12004:PCNA; NbExp=1; IntAct=EBI-716569, EBI-358311; P49005:POLD2; NbExp=1; IntAct=EBI-716569, EBI-372354; Q9HCU8:POLD4; NbExp=2; IntAct=EBI-716569, EBI-864968; O75365:PTP4A3; NbExp=1; IntAct=EBI-716569, EBI-1043866; P12931:SRC; NbExp=1; IntAct=EBI-716569, EBI-621482;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: In eukaryotes there are five DNA polymerases: alpha, beta, gamma, delta, and epsilon which are responsible for different reactions of DNA synthesis.
SIMILARITY: Belongs to the DNA polymerase type-B family.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
50403732 156616275 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | P28340 |
P28340 |
| PFAM: |
PF00136 PF03104 |
PF00136 PF03104 |
| InterPro: |
IPR006172 IPR006134 IPR017964 IPR006133 IPR004578 IPR022762 IPR012337 |
IPR006172 IPR006134 IPR017964 IPR006133 IPR004578 IPR022762 IPR012337 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MDGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRL QEQEEEELQSVLEGVADGQVPPSAIDPRWLRPTPPALDPQTEPLIFQQLE IDHYVGPAQPVPGGPPPSRGSVPVLRAFGVTDEGFSVCCHIHGFAPYFYT PAPPGFGPEHMGDLQRELNLAISRDSRGGRELTGPAVLAVELCSRESMFG YHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPSFAPYEANVDF EIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPP EGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPF LRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQN FDLPYLISRAQTLKVQTFPFLGRVAGLCSNIRDSSFQSKQTGRRDTKVVS MVGRVQMDMLQVLLREYKLRSYTLNAVSFHFLGEQKEDVQHSIITDLQNG NDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTGVPLSYLLSRG QQVKVVSQLLRQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIAT LDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRTPTGDEFVKTS VRKGLLPQILENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSV YGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVESKYTVENGYSTSAK VVYGDTDSVMCRFGVSSVAEAMALGREAADWVSGHFPSPIRLEFEKVYFP YLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLVANLVTASLRR LLIDRDPEGAVAHAQDVISDLLCNRIDISQLVITKELTRAASDYAGKQAH VELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSL PIDTQYYLEQQLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVG GLLAFAKRRNCCIGCRTVLSHQGAVCEFCQPRESELYQKEVSHLNALEER FSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVRKDLEDQEQLLRRFG PPGPEAW |
POLD1 (Homo sapiens) is able to recognize following damages:
POLD1 (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Primary structure of the catalytic subunit of human DNA polymerase delta and chromosomal location of the gene. | Chung DW, Zhang JA, Tan CK, Davie EW, So AG, Downey KM | Proc Natl Acad Sci U S A Dec. 15, 1991 |
| Molecular cloning of the cDNA for the catalytic subunit of human DNA polymerase delta. | Yang CL, Chang LS, Zhang P, Hao H, Zhu L, Toomey NL, Lee MY | Nucleic Acids Res Jan. 25, 1992 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Human Werner helicase interacting protein 1 (WRNIP1) functions as a novel modulator for DNA polymerase delta. | Tsurimoto T, Shinozaki A, Yano M, Seki M, Enomoto T | Genes Cells Feb. 1, 2005 |
| Functional roles of p12, the fourth subunit of human DNA polymerase delta. | Li H, Xie B, Zhou Y, Rahmeh A, Trusa S, Zhang S, Gao Y, Lee EY, Lee MY | J Biol Chem May 26, 2006 |
| A quantitative atlas of mitotic phosphorylation. | Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP | Proc Natl Acad Sci U S A Aug. 5, 2008 |
| Lysine acetylation targets protein complexes and co-regulates major cellular functions. | Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M | Science Aug. 14, 2009 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|