Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ubc13p

Ubc13p (Saccharomyces cerevisiae) is product of expression of UBC13 gene.






FUNCTION: Has a role in the DNA error-free postreplication repair (PRR) pathway. The UBC13/MMS2 heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'.

CATALYTIC ACTIVITY: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.

PATHWAY: Protein modification; protein ubiquitination.

SUBUNIT: Heterodimer with MMS2.

INTERACTION: P39525:CEM1; NbExp=1; IntAct=EBI-19777, EBI-4467; P10174:COX7; NbExp=1; IntAct=EBI-19777, EBI-2050505; P53152:MMS2; NbExp=2; IntAct=EBI-19777, EBI-11035; Q06651:PIB1; NbExp=1; IntAct=EBI-19777, EBI-35947; P09938:RNR2; NbExp=1; IntAct=EBI-19777, EBI-15240; P40210:SIP5; NbExp=1; IntAct=EBI-19777, EBI-27280; P41896:TFG2; NbExp=1; IntAct=EBI-19777, EBI-18916; P38988:YHM1; NbExp=1; IntAct=EBI-19777, EBI-24559;

MISCELLANEOUS: Present with 8970 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the ubiquitin-conjugating enzyme family.


NCBI GenPept GI number(s): 6320297
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P52490 P52490
PFAM: - P52490 (Link - using uniprot id)
InterPro: - P52490 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDG
IFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQ
IRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAKK
KPE

Ubc13p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Identification of a novel family of ubiquitin-conjugating enzymes with distinct amino-terminal extensions. Matuschewski K, Hauser HP, Treier M, Jentsch S J Biol Chem Jan. 2, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
Molecular insights into polyubiquitin chain assembly: crystal structure of the Mms2/Ubc13 heterodimer. VanDemark AP, Hofmann RM, Tsui C, Pickart CM, Wolberger C Cell June 15, 2001
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.