Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Ubc13p |
FUNCTION: Has a role in the DNA error-free postreplication repair (PRR) pathway. The UBC13/MMS2 heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'.
CATALYTIC ACTIVITY: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.
PATHWAY: Protein modification; protein ubiquitination.
SUBUNIT: Heterodimer with MMS2.
INTERACTION: P39525:CEM1; NbExp=1; IntAct=EBI-19777, EBI-4467; P10174:COX7; NbExp=1; IntAct=EBI-19777, EBI-2050505; P53152:MMS2; NbExp=2; IntAct=EBI-19777, EBI-11035; Q06651:PIB1; NbExp=1; IntAct=EBI-19777, EBI-35947; P09938:RNR2; NbExp=1; IntAct=EBI-19777, EBI-15240; P40210:SIP5; NbExp=1; IntAct=EBI-19777, EBI-27280; P41896:TFG2; NbExp=1; IntAct=EBI-19777, EBI-18916; P38988:YHM1; NbExp=1; IntAct=EBI-19777, EBI-24559;
MISCELLANEOUS: Present with 8970 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the ubiquitin-conjugating enzyme family.
| NCBI GenPept GI number(s): |
6320297 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P52490 |
P52490 |
| PFAM: | - |
P52490 (Link - using uniprot id) |
| InterPro: | - |
P52490 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDG IFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQ IRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAKK KPE |
Ubc13p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Identification of a novel family of ubiquitin-conjugating enzymes with distinct amino-terminal extensions. | Matuschewski K, Hauser HP, Treier M, Jentsch S | J Biol Chem Jan. 2, 1996 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. | Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. | Nature May 1, 1997 |
| Molecular insights into polyubiquitin chain assembly: crystal structure of the Mms2/Ubc13 heterodimer. | VanDemark AP, Hofmann RM, Tsui C, Pickart CM, Wolberger C | Cell June 15, 2001 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|