Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Tfb2p

Protein FULL name:

Subunit of TFIIH and nucleotide excision repair factor 3 complexes, involved in transcription initiation, required for nucleotide excision repair, similar to 52 kDa subunit of human TFIIH


Tfb2p (Saccharomyces cerevisiae) is product of expression of TFB2 gene.






FUNCTION: Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro.

SUBUNIT: Component of the TFIIH core complex, which is composed of RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.

SUBCELLULAR LOCATION: Nucleus (By similarity).

MISCELLANEOUS: Present with 8900 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the TFB2 family.


This protein can be a part of a given complexes:
NCBI GenPept GI number(s): 6325135
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q02939 Q02939
PFAM: - Q02939 (Link - using uniprot id)
InterPro: - Q02939 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSDYSLKHSVTQYLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAM
VFNENEVPLLDLDKWVNSNGKLQFQNAIKSMKSLHLLIPNKSSGTLMINL
NPTFKISLRNALTGGEVQNSFGVVVEENVVSLDLLDEYSANKWETILHFM
VGTPLAKIPSEKVLNLLKHSKLMEEVNSTGEFKITNEGFQFLLQEINSQL
WTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKIDALSETQRIML
QDMRDYGLVFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNR
EEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSY
SNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYL
ETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDR
VITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQ
VLDFAKRKLKKKQ

Tfb2p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
RNA polymerase transcription factor IIH holoenzyme from yeast. Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD J Biol Chem Nov. 11, 1994
Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair. Sung P, Guzder SN, Prakash L, Prakash S J Biol Chem May 3, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature May 1, 1997
Genes for Tfb2, Tfb3, and Tfb4 subunits of yeast transcription/repair factor IIH. Homology to human cyclin-dependent kinase activating kinase and IIH subunits. Feaver WJ, Henry NL, Wang Z, Wu X, Svejstrup JQ, Bushnell DA, Friedberg EC, Kornberg RD J Biol Chem Aug. 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH. Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD J Biol Chem Nov. 7, 2003


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.