Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Tfb3p

Protein FULL name:

Subunit of TFIIH and nucleotide excision repair factor 3 complexes, involved in transcription initiation, required for nucleotide excision repair; ring finger protein similar to mammalian CAK and TFIIH subunit


Tfb3p (Saccharomyces cerevisiae) is product of expression of TFB3 gene.






FUNCTION: Acts as component of the general transcription and DNA repair factor IIH (TFIIH or factor B), which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro.

SUBUNIT: Component of the transcription factor IIH (TFIIH) holo but not the TFIIH core complex. Component of a complex consisting of KIN28, CCL1 and TFB3; the KIN28-CCL1 dimer is known as the TFIIK complex.

INTERACTION: P37366:CCL1; NbExp=1; IntAct=EBI-31406, EBI-4385; P06839:RAD3; NbExp=1; IntAct=EBI-31406, EBI-14762;

SUBCELLULAR LOCATION: Nucleus (By similarity).

MISCELLANEOUS: Present with 3050 molecules/cell in log phase SD medium.

SIMILARITY: Contains 1 RING-type zinc finger.

SEQUENCE CAUTION: Sequence=AAB40629.1; Type=Frameshift; Positions=262;


This protein can be a part of a given complexes:
NCBI GenPept GI number(s): 6320668
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q03290 Q03290
PFAM: - Q03290 (Link - using uniprot id)
InterPro: - Q03290 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MLMDEYEENKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLG
PAQCPYKGCDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFN
GDLVEYNKYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIMNNLER
SRTEIESFEQRQKFEKEMKLKKRLLERQIEEEERMNKEWTKKEIVNRLST
TTQDINETIEGVKNTVKLKKSSARRKLEELNRVLKNNPYFNSNVNVQNSR
LKDAVPFTPFNGDREAHPRFTLKGSVYNDPFIKDLEHRKEFIASGFNTNY
AYERVLTEAFMGLGCVISEEL

Tfb3p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
Genes for Tfb2, Tfb3, and Tfb4 subunits of yeast transcription/repair factor IIH. Homology to human cyclin-dependent kinase activating kinase and IIH subunits. Feaver WJ, Henry NL, Wang Z, Wu X, Svejstrup JQ, Bushnell DA, Friedberg EC, Kornberg RD J Biol Chem Aug. 1, 1997
Rig2, a RING finger protein that interacts with the Kin28/Ccl1 CTD kinase in yeast. Faye G, Simon M, Valay JG, Fesquet D, Facca C Mol Gen Genet Aug. 1, 1997
Kin28 is found within TFIIH and a Kin28-Ccl1-Tfb3 trimer complex with differential sensitivities to T-loop phosphorylation. Keogh MC, Cho EJ, Podolny V, Buratowski S Mol Cell Biol March 1, 2002
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH. Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD J Biol Chem Nov. 7, 2003
Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Gruhler A, Olsen JV, Mohammed S, Mortensen P, Faergeman NJ, Mann M, Jensen ON Mol Cell Proteomics March 1, 2005
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res March 1, 2007
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A June 19, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.