Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

UvrA

Protein FULL name:

ATPase and DNA damage recognition protein of nucleotide excision repair excinuclease UvrABC [Escherichia coli str. K-12 substr. MG1655].


UvrA (Escherichia coli strain K-12 substr. MG1655) is product of expression of uvrA gene.


UvrA is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     
NER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of 2 uvrA and 2 uvrB subunits scans DNA for abnormalities. When the presence of a lesion has been verified by uvrB, the uvrA molecules dissociate (By similarity).

SUBUNIT: Forms a heterotetramer with uvrB during the search for lesions (By similarity).

INTERACTION: P00864:ppc; NbExp=1; IntAct=EBI-552091, EBI-1133741; P07648:recC; NbExp=1; IntAct=EBI-552091, EBI-556823;

SUBCELLULAR LOCATION: Cytoplasm (By similarity).

MISCELLANEOUS: Binds about 2 zinc atoms/molecule.

SIMILARITY: Belongs to the ABC transporter superfamily. UvrA family.

SIMILARITY: Contains 2 ABC transporter domains.


NCBI GenPept GI number(s): 16131884
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A698 P0A698
PFAM: - P0A698 (Link - using uniprot id)
InterPro: - P0A698 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: 1x9z 1x9z


Protein sequence:
MDKIEVRGARTHNLKNINLVIPRDKLIVVTGLSGSGKSSLAFDTLYAEGQ
RRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGT
ITEIHDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVLSQPEGKRLML
LAPIIKERKGEHTKTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTI
EVVVDRFKVRDDLTQRLAESFETALELSGGTAVVADMDDPKAEELLFSAN
FACPICGYSMRELEPRLFSFNNPAGACPTCDGLGVQQYFDPDRVIQNPEL
SLAGGAIRGWDRRNFYYFQMLKSLADHYKFDVEAPWGSLSANVHKVVLYG
SGKENIEFKYMNDRGDTSIRRHPFEGVLHNMERRYKETESSAVREELAKF
ISNRPCASCEGTRLRREARHVYVENTPLPAISDMSIGHAMEFFNNLKLAG
QRAKIAEKILKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQ
IGAGLVGVMYVLDEPSIGLHQRDNERLLGTLIHLRDLGNTVIVVEHDEDA
IRAADHVIDIGPGAGVHGGEVVAEGPLEAIMAVPESLTGQYMSGKRKIEV
PKKRVPANPEKVLKLTGARGNNLKDVTLTLPVGLFTCITGVSGSGKSTLI
NDTLFPIAQRQLNGATIAEPAPYRDIQGLEHFDKVIDIDQSPIGRTPRSN
PATYTGVFTPVRELFAGVPESRARGYTPGRFSFNVRGGRCEACQGDGVIK
VEMHFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFF
DAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTG
QTLYILDEPTTGLHFADIQQLLDVLHKLRDQGNTIVVIEHNLDVIKTADW
IVDLGPEGGSGGGEILVSGTPETVAECEASHTARFLKPML

Solved crystal structures:
References:

Title Authors Journal
LexA protein inhibits transcription of the E. coli uvrA gene in vitro. Sancar A, Sancar GB, Rupp WD, Little JW, Mount DW Nature July 1, 1982
In vivo regulation of the uvrA gene: role of the "-10" and "-35" promoter regions. Backendorf C, Brandsma JA, Kartasova T, van de Putte P Nucleic Acids Res Sept. 10, 1983
Sequences of Escherichia coli uvrA gene and protein reveal two potential ATP binding sites. Husain I, Van Houten B, Thomas DC, Sancar A. J Biol Chem. April 15, 1986
Evidence from extended X-ray absorption fine structure and site-specific mutagenesis for zinc fingers in UvrA protein of Escherichia coli. Navaratnam S, Myles GM, Strange RW, Sancar A J Biol Chem Sept. 25, 1989
Isolation and characterization of functional domains of UvrA. Myles GM, Sancar A Biochemistry April 23, 1991
Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL Nucleic Acids Res Nov. 25, 1993
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.