Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Dpb3p

Dpb3p (Saccharomyces cerevisiae) is product of expression of DPB3 gene.


Dpb3p is involved in:

MMR in Saccharomyces cerevisiae BER in Saccharomyces cerevisiae HRR in Saccharomyces cerevisiae
     
NER in Saccharomyces cerevisiae

Keywords:



FUNCTION: DNA polymerase epsilon (DNA polymerase II) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

SUBUNIT: DNA polymerase epsilon is a heterotetramer consisting of POL2, DPB2, DPB3 and DPB4.

INTERACTION: P36156:ECM4; NbExp=1; IntAct=EBI-6076, EBI-2042717;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: In eukaryotes there are five DNA polymerases: alpha, beta, gamma, delta, and epsilon which are responsible for different reactions of DNA synthesis.

MISCELLANEOUS: Present with 784 molecules/cell in log phase SD medium.


NCBI GenPept GI number(s): 429123
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P27344 P27344
PFAM: - P27344 (Link - using uniprot id)
InterPro: IPR009072
IPR009072
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSNLVKEKAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLV
EESLVLAQLNSKGKTSLRLSLNSIEECVEKRDNFRFLEDAIKQLKKNSAL
DKKRELNMQPGRSDQEVVIEEPELHEDDGVEEEEEEDEVSEEEEPVHNEE
LLDDSKDQQNDKSTRSVASLLSRFQYKSALDVGEHSDSSDIEVDHTKSTD
P

Dpb3p (Saccharomyces cerevisiae) is able to recognize following damages:
References:

Title Authors Journal
Cloning DPB3, the gene encoding the third subunit of DNA polymerase II of Saccharomyces cerevisiae. Araki H, Hamatake RK, Morrison A, Johnson AL, Johnston LH, Sugino A Nucleic Acids Res Sept. 25, 1991
The sequence of a 32,420 bp segment located on the right arm of chromosome II from Saccharomyces cerevisiae. Holmstrom K, Brandt T, Kallesoe T Yeast April 1, 1994
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, et al. EMBO J Dec. 15, 1994
Structure and function of the fourth subunit (Dpb4p) of DNA polymerase epsilon in Saccharomyces cerevisiae. Ohya T, Maki S, Kawasaki Y, Sugino A Nucleic Acids Res Oct. 15, 2000
Fidelity of DNA polymerase epsilon holoenzyme from budding yeast Saccharomyces cerevisiae. Shimizu K, Hashimoto K, Kirchner JM, Nakai W, Nishikawa H, Resnick MA, Sugino A J Biol Chem Oct. 4, 2002
The quaternary structure of DNA polymerase epsilon from Saccharomyces cerevisiae. Chilkova O, Jonsson BH, Johansson E J Biol Chem April 18, 2003
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A Jan. 13, 2007
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res March 1, 2007
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A June 19, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.