Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecF

Protein FULL name:

RecF [Escherichia coli].


RecF (Escherichia coli strain K-12 substr. MG1655) is product of expression of recF gene.


RecF is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655




FUNCTION: The recF protein is involved in DNA metabolism; it is required for DNA replication and normal SOS inducibility. RecF binds preferentially to single-stranded, linear DNA. It also seems to bind ATP.

INTERACTION: P0A6F5:groL; NbExp=1; IntAct=EBI-556839, EBI-543750;

SUBCELLULAR LOCATION: Cytoplasm (By similarity).

SIMILARITY: Belongs to the recF family.


NCBI GenPept GI number(s): 147539
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A7H0 P0A7H0
PFAM: - P0A7H0 (Link - using uniprot id)
InterPro: - P0A7H0 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGR
AFRSLQIGRVIRHEQEAFVLHGRLQGEERETAIGLTKDKQGDSKVRIDGT
DGHKVAELAHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEPGFFTA
WSNLKRLLKQRNAALRQVTRYEQLRPWDKELIPLAEQISTWRAEYSAGIA
ADMADTCKQFLPEFSLTFSFQRGWEKETEYAEVLERNFERDRQLTYTAHG
PHKADLRIRADGAPVEDTLSRGQLKLLMCALRLAQGEFLTRESGRRCLYL
IDDFASELDDERRGLLASRLKATQSQVFVSAISAEHVIDMSDENSKMFTV
EKGKITD

References:

Title Authors Journal
Molecular analysis of the recF gene of Escherichia coli. Blanar MA, Sandler SJ, Armengod ME, Ream LW, Clark AJ Proc Natl Acad Sci U S A Aug. 1, 1984
DNA sequence and transcription of the region upstream of the E. coli gyrB gene. Adachi T, Mizuuchi K, Menzel R, Gellert M Nucleic Acids Res Aug. 24, 1984
Purification and preliminary characterization of the Escherichia coli K-12 recF protein. Griffin TJ 4th, Kolodner RD J Bacteriol Nov. 1, 1990
Sequence and complementation analysis of recF genes from Escherichia coli, Salmonella typhimurium, Pseudomonas putida and Bacillus subtilis: evidence for an essential phosphate binding loop. Sandler SJ, Chackerian B, Li JT, Clark AJ Nucleic Acids Res Jan. 25, 1992
DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication. Burland V, Plunkett G 3rd, Daniels DL, Blattner FR Genomics June 1, 1993
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.