Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RAD52 |
Protein FULL name:
RAD52 homolog isoform alpha [Homo sapiens].
RAD52 (Homo sapiens) is product of expression of RAD52 gene.
RAD52 is involved in:
HRR in Homo sapiens
Keywords:
FUNCTION: Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase.
SUBUNIT: Forms a undecameric ring.
INTERACTION: Q14191:WRN; NbExp=4; IntAct=EBI-706448, EBI-368417;
SUBCELLULAR LOCATION: Nucleus (Potential).
PTM: Phosphorylated upon DNA damage, probably by ATM or ATR.
SIMILARITY: Belongs to the RAD52 family.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
20143952 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | P43351 |
P43351 |
| PFAM: | - |
P43351 (Link - using uniprot id) |
| InterPro: | - |
P43351 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPE YISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNN GKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDG LKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSV EEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVE SEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRAD PAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGN WESHRKSQDMKKRKYDPSY |
RAD52 (Homo sapiens) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Cloning of human and mouse genes homologous to RAD52, a yeast gene involved in DNA repair and recombination. | Muris DF, Bezzubova O, Buerstedde JM, Vreeken K, Balajee AS, Osgood CJ, Troelstra C, Hoeijmakers JH, Ostermann K, Schmidt H, et al. | Mutat Res Nov. 1, 1994 |
| The human and mouse homologs of the yeast RAD52 gene: cDNA cloning, sequence analysis, assignment to human chromosome 12p12.2-p13, and mRNA expression in mouse tissues. | Shen Z, Denison K, Lobb R, Gatewood JM, Chen DJ | Genomics Feb. 1, 1995 |
| Expression of human RAD52 confers resistance to ionizing radiation in mammalian cells. | Park MS | J Biol Chem June 1, 1995 |
| Structure of the single-strand annealing domain of human RAD52 protein. | Singleton MR, Wentzell LM, Liu Y, West SC, Wigley DB | Proc Natl Acad Sci U S A Oct. 15, 2002 |
| ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. | Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ | Science May 25, 2007 |
| Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. | Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M | Mol Cell Aug. 8, 2008 |
Last modification of this entry: Oct. 21, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|