Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

POLQ

Protein FULL name:

DNA polymerase theta isoform 1 [Homo sapiens].


POLQ (Homo sapiens) is product of expression of POLQ gene.


POLQ is involved in:

TLS in Homo sapiens
     


Keywords:



FUNCTION: Could be involved in the repair of interstrand cross- links.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

SIMILARITY: Belongs to the DNA polymerase type-A family.


NCBI GenPept GI number(s): 40805845
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O75417 O75417
PFAM: - O75417 (Link - using uniprot id)
InterPro: - O75417 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MNGHRFTFRTRSLLPLQKGQHRCITKLLAHNDPWGIFRAPSSRRSYSVSG
VCQPAIPNSSLHIPHNACWLKWKLCSEIALPYHHILGERRKLCSIRKFED
WREDVRSCCQARVLPRGRTLGLWLALIGREEFAMNLLRRSGKRRRSESGS
DSFSGSGGDSSASPQFLSGSVLSPPPGLGRCLKAAAAGECKPTVPDYERD
KLLLANWGLPKAVLEKYHSFGVKKMFEWQAECLLLGQVLEGKNLVYSAPT
SAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQSLFQEVGIK
VDGYMGSTSPSRHFSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDE
LHMLGDSHRGYLLELLLTKICYITRKSASCQADLASSLSNAVQIVGMSAT
LPNLELVASWLNAELYHTDFRPVPLLESVKVGNSIYDSSMKLVREFEPML
QVKGDEDHVVSLCYETICDNHSVLLFCPSKKWCEKLADIIAREFYNLHHQ
AEGEGLVKPSECPPVILEQKELLEVMDQLRRLPSGLDSVLQKTVPWGVAF
HHAGLTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFG
GRPLDILTYKQMVGRAGRKGVDTVGESILICKNSEKSKGIALLQGSLKPV
RSCLQRREGEEVTGSMIRAILEIIVGGVASTSQDMHTYAACTFLAASMKE
GKQGIQRNQESVQLGAIEACVMWLLENEFIQSTEASDGTEGKVYHPTHLG
SATLSSSLSPADTLDIFADLQRAMKGFVLENDLHILYLVTPMFEDWTTID
WYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAI
HKRFFTSLVLLDLISEVPLREINQKYGCNRGQIQSLQQSAAVYAGMITVF
SNRLGWHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGF
HTVADLARANIVEVEVILKNAVPFKSARKAVDEEEEAVEERRNMRTIWVT
GRKGLTEREAAALIVEEARMILQQDLVEMGVQWNPCALLHSSTCSLTHSE
SEVKEHTFISQTKSSYKKLTSKNKSNTIFSDSYIKHSPNIVQDLNKSREH
TSSFNCNFQNGNQEHQTCSIFRARKRASLDINKEKPGASQNEGKTSDKKV
VQTFSQKTKKAPLNFNSEKMSRSFRSWKRRKHLKRSRDSSPLKDSGACRI
HLQGQTLSNPSLCEDPFTLDEKKTEFRNSGPFAKNVSLSGKEKDNKTSFP
LQIKQNCSWNITLTNDNFVEHIVTGSQSKNVTCQATSVVSEKGRGVAVEA
EKINEVLIQNGSKNQNVYMKHHDIHPINQYLRKQSHEQTSTITKQKNIIE
RQMPCEAVSSYINRDSNVTINCERIKLNTEENKPSHFQALGDDISRTVIP
SEVLPSAGAFSKSEGQHENFLNISRLQEKTGTYTTNKTKNNHVSDLGLVL
CDFEDSFYLDTQSEKIIQQMATENAKLGAKDTNLAAGIMQKSLVQQNSMN
SFQKECHIPFPAEQHPLGATKIDHLDLKTVGTMKQSSDSHGVDILTPESP
IFHSPILLEENGLFLKKNEVSVTDSQLNSFLQGYQTQETVKPVILLIPQK
RTPTGVEGECLPVPETSLNMSDSLLFDSFSDDYLVKEQLPDMQMKEPLPS
EVTSNHFSDSLCLQEDLIKKSNVNENQDTHQQLTCSNDESIIFSEMDSVQ
MVEALDNVDIFPVQEKNHTVVSPRALELSDPVLDEHHQGDQDGGDQDERA
EKSKLTGTRQNHSFIWSGASFDLSPGLQRILDKVSSPLENEKLKSMTINF
SSLNRKNTELNEEQEVISNLETKQVQGISFSSNNEVKSKIEMLENNANHD
ETSSLLPRKESNIVDDNGLIPPTPIPTSASKLTFPGILETPVNPWKTNNV
LQPGESYLFGSPSDIKNHDLSPGSRNGFKDNSPISDTSFSLQLSQDGLQL
TPASSSSESLSIIDVASDQNLFQTFIKEWRCKKRFSISLACEKIRSLTSS
KTATIGSRFKQASSPQEIPIRDDGFPIKGCDDTLVVGLAVCWGGRDAYYF
SLQKEQKHSEISASLVPPSLDPSLTLKDRMWYLQSCLRKESDKECSVVIY
DFIQSYKILLLSCGISLEQSYEDPKVACWLLDPDSQEPTLHSIVTSFLPH
ELPLLEGMETSQGIQSLGLNAGSEHSGRYRASVESILIFNSMNQLNSLLQ
KENLQDVFRKVEMPSQYCLALLELNGIGFSTAECESQKHIMQAKLDAIET
QAYQLAGHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGI
DNGRKLRLGRQFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPLQ
REKCLNPFLGMERIYPVSQSHTATGRITFTEPNIQNVPRDFEIKMPTLVG
ESPPSQAVGKGLLPMGRGKYKKGFSVNPRCQAQMEERAADRGMPFSISMR
HAFVPFPGGSILAADYSQLELRILAHLSHDRRLIQVLNTGADVFRSIAAE
WKMIEPESVGDDLRQQAKQICYGIIYGMGAKSLGEQMGIKENDAACYIDS
FKSRYTGINQFMTETVKNCKRDGFVQTILGRRRYLPGIKDNNPYRKAHAE
RQAINTIVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSDQTG
LSRKRKLQGMFCPIRGGFFILQLHDELLYEVAEEDVVQVAQIVKNEMESA
VKLSVKLKVKVKIGASWGELKDFDV

POLQ (Homo sapiens) is able to recognize following damages:
References:

Title Authors Journal
Cloning and chromosomal mapping of the human DNA polymerase theta (POLQ), the eighth human DNA polymerase. Sharief FS, Vojta PJ, Ropp PA, Copeland WC Genomics July 1, 1999
Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Wang B, Malik R, Nigg EA, Korner R Anal Chem Dec. 15, 2008
Lysine acetylation targets protein complexes and co-regulates major cellular functions. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M Science Aug. 14, 2009


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.