Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

PMS1

Protein FULL name:

PMS1 protein homolog 1 isoform a [Homo sapiens].


PMS1 (Homo sapiens) is product of expression of PMS1 gene.

Human diseases related to this protein:

PMS1 is involved in:

MMR in Homo sapiens
     


Keywords:



FUNCTION: Probably involved in the repair of mismatches in DNA.

SUBCELLULAR LOCATION: Nucleus (Potential).

DISEASE: Defects in PMS1 are the cause of hereditary non-polyposis colorectal cancer type 3 (HNPCC3) [MIM:600258]. Mutations in more than one gene locus can be involved alone or in combination in the production of the HNPphenotype (also called Lynch syndrome). Most families with clinically recognized HNPhave mutations in either MLH1 or MSH2 genes. HNPis an autosomal, dominantly inherited disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early onset colorectal carcinoma (CRC) and extra-colonic cancers of the gastrointestinal, urological and female reproductive tracts. HNPis reported to be the most common form of inherited colorectal cancer in the Western world, and accounts for 15% of all colon cancers. Cancers in HNPoriginate within benign neoplastic polyps termed adenomas. Clinically, HNPis often divided into two subgroups. Type I: hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II: patients have an increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical HNPis based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected HNPCC' or 'incomplete HNPCC' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected.

SIMILARITY: Belongs to the DNA mismatch repair mutL/hexB family.

SIMILARITY: Contains 1 HMG box DNA-binding domain.

WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; [LINK]

WEB RESOURCE: Name=Hereditary non-polyposis colorectal cancer db; [LINK]

WEB RESOURCE: Name=NIEHS-SNPs; [LINK]


NCBI GenPept GI number(s): 4505911
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P54277 P54277
PFAM: - P54277 (Link - using uniprot id)
InterPro: - P54277 (Link - using uniprot id)
CATH: None  
SCOP: None  
PDB: - -


Protein sequence:
MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFD
KIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSI
CCIAEVLITTRTAADNFSTQYVLDGSGHILSQKPSHLGQGTTVTALRLFK
NLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLRIVFVHNKAVIWQK
SRVSDHKMALMSVLGTAVMNNMESFQYHSEESQIYLSGFLPKCDADHSFT
SLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKID
VPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLPSTNSYENNK
TDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESG
KNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQ
TEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSR
GNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKS
NVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLED
ATLQIEELWKTLSEEEKLKYEEKATKDLERYNSQMKRAIEQESQMSLKDG
RKKIKPTSAWNLAQKHKLKTSLSNQPKLDELLQSQIEKRRSQNIKMVQIP
FSMKNLKINFKKQNKVDLEEKDEPCLIHNLRFPDAWLMTSKTEVMLLNPY
RVEEALLFKRLLENHKLPAEPLEKPIMLTESLFNGSHYLDVLYKMTADDQ
RYSGSTYLSDPRLTANGFKIKLIPGVSITENYLEIEGMANCLPFYGVADL
KEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDI
IYRMKHQFGNEIKECVHGRPFFHHLTYLPETT

PMS1 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal
Mutations of two PMS homologues in hereditary nonpolyposis colon cancer. Nicolaides NC, Papadopoulos N, Liu B, Wei YF, Carter KC, Ruben SM, Rosen CA, Haseltine WA, Fleischmann RD, Fraser CM, et al. Nature Sept. 1, 1994
Prevalence of germline mutations of hMLH1, hMSH2, hPMS1, hPMS2, and hMSH6 genes in 75 French kindreds with nonpolyposis colorectal cancer. Wang Q, Lasset C, Desseigne F, Saurin JC, Maugard C, Navarro C, Ruano E, Descos L, Trillet-Lenoir V, Bosset JF, Puisieux A Hum Genet Jan. 1, 1999


Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.