Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad50p

Rad50p (Saccharomyces cerevisiae) is product of expression of RAD50 gene.


Rad50p is involved in:

NHEJ in Saccharomyces cerevisiae HRR in Saccharomyces cerevisiae

Keywords:



FUNCTION: Involved in DNA double-strand break repair (DSBR). The rad50/mre11 complex possesses single-strand endonuclease activity and ATP-dependent double-strand-specific exonuclease activity. Rad50 provides ATP-dependent control of mre11 by unwinding and/or repositioning DNA ends into the mre11 active site.

COFACTOR: Binds 1 zinc ion per homodimer (By similarity).

SUBUNIT: Homodimer (By similarity). Forms a complex with MRE11.

INTERACTION: P25390:SSK22; NbExp=1; IntAct=EBI-14700, EBI-18129;

DOMAIN: The zinc-hook, which separates the large intramolecular coiled coil regions, contains 2 Cys residues that coordinate one molecule of zinc with the help of the 2 Cys residues of the zinc- hook of another RAD50 molecule, thereby forming a V-shaped homodimer (By similarity).

MISCELLANEOUS: Present with 830 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the SMC family. RAD50 subfamily.

SIMILARITY: Contains 1 zinc-hook domain.


NCBI GenPept GI number(s): 1255968
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P12753 P12753
PFAM: - P12753 (Link - using uniprot id)
InterPro: IPR003395
IPR003439
IPR004584
IPR007517
IPR013134
IPR003395
IPR003439
IPR004584
IPR007517
IPR013134
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGMNGSGKTTIIECLKYA
TTGDLPPNSKGGVFIHDPKITGEKDIRAQVKLAFTSANGLNMIVTRNIQL
LMKKTTTTFKTLEGQLVAINNSGDRSTLSTRSLELDAQVPLYLGVPKAIL
EYVIFCHQEDSLWPLSEPSNLKKKFDEIFQAMKFTKALDNLKSIKKDMSV
DIKLLKQSVEHLKLDKDRSKAMKLNIHQLQTKIDQYNEEVSEIESQLNEI
TEKSDKLFKSNQDFQKILSKVENLKNTKLSISDQVKRLSNSIDILDLSKP
DLQNLLANFSKVLMDKNNQLRDLETDISSLKDRQSSLQSLSNSLIRRQGE
LEAGKETYEKNRNHLSSLKEAFQHKFQGLSNIENSDMAQVNHEMSQFKAF
ISQDLTDTIDQFAKDIQLKETNLSDLIKSITVDSQNLEYNKKDRSKLIHD
SEELAEKLKSFKSLSTQDSLNHELENLKTYKEKLQSWESENIIPKLNQKI
EEKNNEMIILENQIEKFQDRIMKTNQQADLYAKLGLIKKSINTKLDELQK
ITEKLQNDSRIRQVFPLTQEFQRADLEMDFQKLFINMQKNIAINNKKMHE
LDRRYTNALYNLNTIEKDLQDNQKSKEKVIQLLSENLPEDCTIDEYNDVL
EETELSYKTALENLKMHQTTLEFNRKALEIAERDSCCYLCSRKFENESFK
SKLLQELKTKTDANFEKTLKDTVQNEKEYLHSLRLLEKHIITLNSINEKI
DNSQKCLEKAKEETKTSKSKLDELEVDSTKLKDEKELAESEIRPLIEKFT
YLEKELKDLENSSKTISEELSIYNTSEDGIQTVDELRDQQRKMNDSLREL
RKTISDLQMEKDEKVRENSRMINLIKEKELTVSEIESSLTQKQNIDDSIR
SKRENINDIDSRVKELEARIISLKNKKDEAQSVLDKVKNERDIQVRNKQK
TVADINRLIDRFQTIYNEVVDFEAKGFDELQTTIKELELNKAQMLELKEQ
LDLKSNEVNEEKRKLADSNNEEKNLKQNLELIELKSQLQHIESEISRLDV
QNAEAERDKYQEESLRLRTRFEKLSSENAGKLGEMKQLQNQIDSLTHQLR
TDYKDIEKNYHKEWVELQTRSFVTDDIDVYSKALDSAIMKYHGLKMQDIN
RIIDELWKRTYSGTDIDTIKIRSDEVSSTVKGKSYNYRVVMYKQDVELDM
RGRCSAGQKVLASIIIRLALSETFGANCGVIALDEPTTNLDEENIESLAK
SLHNIINMRRHQKNFQLIVITHDEKFLGHMNAAAFTDHFFKVKRDDRQKS
QIEWVDINRVTY

References:

Title Authors Journal
The yeast RAD50 gene encodes a predicted 153-kD protein containing a purine nucleotide-binding domain and two large heptad-repeat regions. Alani E, Subbiah S, Kleckner N Genetics May 1, 1989
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications. Philippsen P, Kleine K, Pohlmann R, Dusterhoft A, Hamberg K, Hegemann JH, Obermaier B, Urrestarazu LA, Aert R, Albermann K, Altmann R, Andre B, Baladron V, Ballesta JP, Becam AM, Beinhauer J, Boskovic J, Buitrago MJ, Bussereau F, Coster F, Crouzet M, D'Angelo M, Dal Pero F, De Antoni A, Hani J, et al. Nature May 1, 1997
Sequence analysis of the 33 kb long region between ORC5 and SUI1 from the left arm of chromosome XIV from Saccharomyces cerevisiae. Sen-Gupta M, Guldener U, Beinhauer J, Fiedler T, Hegemann JH Yeast July 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.