Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad51p

Rad51p (Saccharomyces cerevisiae) is product of expression of RAD51 gene.


Rad51p is involved in:

HRR in Saccharomyces cerevisiae




FUNCTION: Required both for recombination and for the repair of DNA damage caused by X-rays. Its function may be modulated by interaction with other repair proteins. RAD52 interacts directly with RAD51, via its C-terminus. Forms a nucleoprotein filament with DNA as an early intermediate in recombination.

SUBUNIT: Part of a repair/recombination complex that includes RAD51, RAD52 and RAD54. Interacts with HED1, RDH54 and SAW1.

INTERACTION: Self; NbExp=2; IntAct=EBI-14709, EBI-14709; P32288:GLN1; NbExp=1; IntAct=EBI-14709, EBI-7665; P29295:HRR25; NbExp=1; IntAct=EBI-14709, EBI-8536; P38920:MLH1; NbExp=1; IntAct=EBI-14709, EBI-11003; P38953:RAD55; NbExp=1; IntAct=EBI-14709, EBI-14737;

SUBCELLULAR LOCATION: Nucleus. Note=Localizes as foci on meiotic chromosomes.

DEVELOPMENTAL STAGE: RAD51 is cell cycle regulated, peaking around the G1-to-S transition.

INDUCTION: By X-rays.

MISCELLANEOUS: Present with 6960 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the recA family. RAD51 subfamily.

SIMILARITY: Contains 1 HhH domain.


NCBI GenPept GI number(s): 4275
6320942
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P25454 P25454
PFAM: - P25454 (Link - using uniprot id)
InterPro: IPR000445
IPR001553
IPR003593
IPR010995
IPR011941
IPR013632
IPR000445
IPR001553
IPR003593
IPR010995
IPR011941
IPR013632
CATH: - -
SCOP: - -
PDB: 1SZP 1SZP


Protein sequence:
MSQVQEQHISESQLQYGNGSLMSTVPADLSQSVVDGNGNGSSEDIEATNG
SGDGGGLQEQAEAQGEMEDEAYDEAALGSFVPIEKLQVNGITMADVKKLR
ESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADF
HMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAV
TCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYA
RAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGRGELSARQ
MHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGGMAFNPDPKKPIGGNIM
AHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPREEDE

Rad51p (Saccharomyces cerevisiae) is able to recognize following damages:
Solved crystal structures:
References:

Title Authors Journal
Rad51 protein involved in repair and recombination in S. cerevisiae is a RecA-like protein. Shinohara A, Ogawa H, Ogawa T Cell May 1, 1992
Nucleotide sequence and transcriptional regulation of the yeast recombinational repair gene RAD51. Basile G, Aker M, Mortimer RK Mol Cell Biol July 1, 1992
Semidominant suppressors of Srs2 helicase mutations of Saccharomyces cerevisiae map in the RAD51 gene, whose sequence predicts a protein with similarities to procaryotic RecA proteins. Aboussekhra A, Chanet R, Adjiri A, Fabre F Mol Cell Biol July 1, 1992
The nucleotide sequence of Saccharomyces cerevisiae chromosome V. Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al. Nature May 1, 1997
Catalysis of homologous DNA pairing by yeast Rad51 and Rad54 proteins. Petukhova G, Stratton S, Sung P Nature May 7, 1998
Promotion of Rad51-dependent D-loop formation by yeast recombination factor Rdh54/Tid1. Petukhova G, Sung P, Klein H Genes Dev Sept. 1, 2000
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Crystal structure of a Rad51 filament. Conway AB, Lynch TW, Zhang Y, Fortin GS, Fung CW, Symington LS, Rice PA Nat Struct Mol Biol Aug. 1, 2004
Budding yeast Hed1 down-regulates the mitotic recombination machinery when meiotic recombination is impaired. Tsubouchi H, Roeder GS Genes Dev July 1, 2006
Microarray-based genetic screen defines SAW1, a gene required for Rad1/Rad10-dependent processing of recombination intermediates. Li F, Dong J, Pan X, Oum JH, Boeke JD, Lee SE Mol Cell May 9, 2008


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.