Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mre11a |
Protein FULL name:
double-strand break repair protein MRE11A [Mus musculus].
Mre11a (Mus musculus) is product of expression of Mre11a gene.
FUNCTION: Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand- specific 3'-5' exonuclease activity, which are provided by MRE11A. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11A to prevent nucleolytic degradation past a given point. The complex may also be required for DNA damage signaling via activation of the ATM kinase. In telomeres the MRN complex may modulate t-loop formation (By similarity).
COFACTOR: Manganese (By similarity).
SUBUNIT: Component of the MRN complex composed of two heterodimers RAD50/MRE11A associated with a single NBN. Component of the BASC complex, at least composed of BRCA1, MSH2, MSH6, MLH1, ATM, BLM, RAD50, MRE11A and NBN. Interacts with DCLRE1C/Artemis (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity). Note=Localizes to discrete nuclear foci after treatment with genotoxic agents (By similarity).
PTM: Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity).
SIMILARITY: Belongs to the MRE11/RAD32 family.
| NCBI GenPept GI number(s): |
9055282 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q61216 |
Q61216 |
| PFAM: | - |
Q61216 (Link - using uniprot id) |
| InterPro: | - |
Q61216 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSPTDPLDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALEN EVDFILLGGDLFHENKPSRKTLHSCLELLRKYCMGDRPVQFEVISDQSVN FGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDVLSCAGFV NHFGRSMSVEKVDISPVLLQKGSTKLALYGLGSIPDERLYRMFVNKKVTM LRPKEDENSWFNLFVIHQNRSKHGNTNFIPEQFLDDFIDLVIWGHEHECK IGPIKNEQQLFYVSQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMQKLP LRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERE RLGNPQQPGKPLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFR HREQKGKTGEEINFGMLITKPASEGATLRVEDLVKQYFQTAEKNVQLSLL TERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDE EVRRFRESRQRNTNEEDDEVREAMSRARALRSQSETSTSAFSAEDLSFDT SEQTANDSDDSLSAVPSRGRGRGRGRRGARGQSSAPRGGSQRGRDTGLEI TTRGRSSKATSSTSRNMSIIDAFRSTRQQPSRNVAPKNYSETIEVDDSDE DDIFPTNSRADQRWSGTTSSKRMSQSQTAKGVDFESDEDDDDDPFMSSSC PRRNRR |
Mre11a (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|