Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
ALKBH3 |
Protein FULL name:
alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 [Homo sapiens].
ALKBH3 (Homo sapiens) is product of expression of ALKBH3 gene.
Human diseases related to this protein:
ALKBH3 is involved in:
DRR in Homo sapiens
Keywords:
FUNCTION: Dioxygenase that repairs alkylated DNA containing 1- methyladenine and 3-methylcytosine by oxidative demethylation. Has a strong preference for single-stranded DNA. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron.
COFACTOR: Binds 1 Fe(2+) ion per subunit.
ENZYME REGULATION: Activated by ascorbate.
SUBCELLULAR LOCATION: Cytoplasm. Nucleus.
TISSUE SPECIFICITY: Ubiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon.
SIMILARITY: Belongs to the alkB family.
SIMILARITY: Contains 1 Fe2OG dioxygenase domain.
SEQUENCE CAUTION: Sequence=AAH15155.1; Type=Erroneous initiation;
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
21040275 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q96Q83 |
Q96Q83 |
| PFAM: | - |
Q96Q83 (Link - using uniprot id) |
| InterPro: | - |
Q96Q83 (Link - using uniprot id) |
| CATH: | None | |
| SCOP: | None | |
| PDB: | - | - |
Protein sequence:
|
MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLS DREFVFKEPQQVVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVK EADWILEQLCQDVPWKQRTGIREDITYQQPRLTAWYGELPYTYSRITMEP NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGR CPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGA TQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW |
ALKBH3 (Homo sapiens) is able to recognize following damages:
ALKBH3 (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Reversal of DNA alkylation damage by two human dioxygenases. | Duncan T, Trewick SC, Koivisto P, Bates PA, Lindahl T, Sedgwick B | Proc Natl Acad Sci U S A Dec. 24, 2002 |
| Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA. | Aas PA, Otterlei M, Falnes PO, Vagbo CB, Skorpen F, Akbari M, Sundheim O, Bjoras M, Slupphaug G, Seeberg E, Krokan HE | Nature Jan. 20, 2003 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Repair of methylation damage in DNA and RNA by mammalian AlkB homologues. | Lee DH, Jin SG, Cai S, Chen Y, Pfeifer GP, O'Connor TR | J Biol Chem Nov. 25, 2005 |
| Human chromosome 11 DNA sequence and analysis including novel gene identification. | Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y | Nature March 23, 2006 |
| Human ABH3 structure and key residues for oxidative demethylation to reverse DNA/RNA damage. | Sundheim O, Vagbo CB, Bjoras M, Sousa MM, Talstad V, Aas PA, Drablos F, Krokan HE, Tainer JA, Slupphaug G | EMBO J July 26, 2006 |
| Expression and sub-cellular localization of human ABH family molecules. | Tsujikawa K, Koike K, Kitae K, Shinkawa A, Arima H, Suzuki T, Tsuchiya M, Makino Y, Furukawa T, Konishi N, Yamamoto H | J Cell Mol Med Jan. 1, 2007 |
Last modification of this entry: Nov. 14, 2020.
Add your own comment!
There is no comment yet.
|
|
|
|