Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

ALKBH3

Protein FULL name:

alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 [Homo sapiens].


ALKBH3 (Homo sapiens) is product of expression of ALKBH3 gene.

Human diseases related to this protein:

ALKBH3 is involved in:

DRR in Homo sapiens

Keywords:



FUNCTION: Dioxygenase that repairs alkylated DNA containing 1- methyladenine and 3-methylcytosine by oxidative demethylation. Has a strong preference for single-stranded DNA. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron.

COFACTOR: Binds 1 Fe(2+) ion per subunit.

ENZYME REGULATION: Activated by ascorbate.

SUBCELLULAR LOCATION: Cytoplasm. Nucleus.

TISSUE SPECIFICITY: Ubiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon.

SIMILARITY: Belongs to the alkB family.

SIMILARITY: Contains 1 Fe2OG dioxygenase domain.

SEQUENCE CAUTION: Sequence=AAH15155.1; Type=Erroneous initiation;

WEB RESOURCE: Name=NIEHS-SNPs; [LINK]


NCBI GenPept GI number(s): 21040275
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q96Q83 Q96Q83
PFAM: - Q96Q83 (Link - using uniprot id)
InterPro: - Q96Q83 (Link - using uniprot id)
CATH: None  
SCOP: None  
PDB: - -


Protein sequence:
MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLS
DREFVFKEPQQVVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVK
EADWILEQLCQDVPWKQRTGIREDITYQQPRLTAWYGELPYTYSRITMEP
NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGR
CPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGA
TQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW

ALKBH3 (Homo sapiens) is able to recognize following damages:
ALKBH3 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal
Reversal of DNA alkylation damage by two human dioxygenases. Duncan T, Trewick SC, Koivisto P, Bates PA, Lindahl T, Sedgwick B Proc Natl Acad Sci U S A Dec. 24, 2002
Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA. Aas PA, Otterlei M, Falnes PO, Vagbo CB, Skorpen F, Akbari M, Sundheim O, Bjoras M, Slupphaug G, Seeberg E, Krokan HE Nature Jan. 20, 2003
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004
Repair of methylation damage in DNA and RNA by mammalian AlkB homologues. Lee DH, Jin SG, Cai S, Chen Y, Pfeifer GP, O'Connor TR J Biol Chem Nov. 25, 2005
Human chromosome 11 DNA sequence and analysis including novel gene identification. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y Nature March 23, 2006
Human ABH3 structure and key residues for oxidative demethylation to reverse DNA/RNA damage. Sundheim O, Vagbo CB, Bjoras M, Sousa MM, Talstad V, Aas PA, Drablos F, Krokan HE, Tainer JA, Slupphaug G EMBO J July 26, 2006
Expression and sub-cellular localization of human ABH family molecules. Tsujikawa K, Koike K, Kitae K, Shinkawa A, Arima H, Suzuki T, Tsuchiya M, Makino Y, Furukawa T, Konishi N, Yamamoto H J Cell Mol Med Jan. 1, 2007


Last modification of this entry: Nov. 11, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.