Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Mph1p

Protein FULL name:

Member of the DEAH family of helicases, functions in an error-free DNA damage bypass pathway that involves homologous recombination, binds to flap DNA and stimulates activity of Rad27p and Dna2p; mutations confer a mutator phenotype


Mph1p (Saccharomyces cerevisiae) is product of expression of MPH1 gene.


Mph1p is involved in:

HRR in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: ATP-dependent DNA helicase involved in error-free DNA damage bypass through homologous recombination.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

SUBCELLULAR LOCATION: Nucleus.

SIMILARITY: Belongs to the DEAH box helicase family. MPH1 subfamily.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SIMILARITY: Contains 1 helicase C-terminal domain.


NCBI GenPept GI number(s): 6322192
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P40562 P40562
PFAM: - P40562 (Link - using uniprot id)
InterPro: - P40562 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MASADDYFSDFEDDELDKLYEKAINKSVKETITRRAVPVQKDLHDNVLPG
QKTVYEEIQRDVSFGPTHHELDYDALSFYVYPTNYEVRDYQYTIVHKSLF
QNTLCAIPTGMGKTFIASTVMLNYFRWTKKAKIIFTAPTRPLVAQQIKAC
LGITGIPSDQTAILLDKSRKNREEIWANKRVFFATPQVVENDLKRGVLDP
KDIVCLVIDEAHRATGSSAYTNVVKFIDRFNSSYRLLALTATPASDLEGV
QEVVNNLDISKIEIRTEESMDIVKYMKKRKKEKIEVPLLLEIEDIIEQLG
MAVKPVLQQAIELGIYEECDPSQINAFKAMQQSQKIIANPTIPEGIKWRN
FFILQLLNNVGQMLKRLKIYGIRTFFNYFQNKCTEFTTKYNLKKSTNKIA
AEFYYHPILKNIKNQCENYLSDPKFVGHGKLQCVRDELMDFFQKRGSDSR
VIIFTELRESALEIVKFIDSVADDQIRPHIFIGQARAKEGFDEVKYTRKH
APKGRKKVERLHRQEQEKFLEAERTKRAANDKLERSARRTGSSEEAQISG
MNQKMQKEVIHNFKKGEYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIK
NIQRMGRTGRKRDGKIVLLFSSNESYKFERAMEDYSTLQALISKQCIDYK
KSDRIIPEDIIPECHETLITINDENEIINEMEDVDEVIRYATQCMMGKKV
KPKKAITKKKRVQENKKPKKFFMPDNVETSIVSASTLINKFLVNESGGKQ
LVTSNENPSKKRKIFKALDNLENDSTEEASSSLETEDEEVSDDNNVFIAE
GQNGCQKDLETAIIRTGESLTTLKPLHNFERPNMALFVNDCGLPTKIEKN
VKDIRGNQHNLEKEKSCTVDKNNMVLSLDDWNFFRNRYIPEGVSFDVEPN
FVQYTKGVKVPHCHKVSKIITLFNDESNDNKKRTIDMNYTKCLARGMLRD
EKKFVKVNDKSQVDNNSVNHDSSQSFTLSNAELDDILGSDSDF

Mph1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Nucleotide sequence and analysis of the centromeric region of yeast chromosome IX. Voss H, Tamames J, Teodoru C, Valencia A, Sensen C, Wiemann S, Schwager C, Zimmermann J, Sander C, Ansorge W Yeast Feb. 1, 1995
The nucleotide sequence of Saccharomyces cerevisiae chromosome IX. Churcher C, Bowman S, Badcock K, Bankier A, Brown D, Chillingworth T, Connor R, Devlin K, Gentles S, Hamlin N, Harris D, Horsnell T, Hunt S, Jagels K, Jones M, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Rowley N, Skelton J, Smith V, Barrell B, et al. Nature May 1, 1997
MPH1, a yeast gene encoding a DEAH protein, plays a role in protection of the genome from spontaneous and chemically induced damage. Scheller J, Schurer A, Rudolph C, Hettwer S, Kramer W Genetics July 1, 2000
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature Oct. 16, 2003
Yeast MPH1 gene functions in an error-free DNA damage bypass pathway that requires genes from Homologous recombination, but not from postreplicative repair. Schurer KA, Rudolph C, Ulrich HD, Kramer W Genetics April 1, 2004
Saccharomyces cerevisiae MPH1 gene, required for homologous recombination-mediated mutation avoidance, encodes a 3' to 5' DNA helicase. Prakash R, Krejci L, Van Komen S, Anke Schurer K, Kramer W, Sung P J Biol Chem March 4, 2005
Genome-wide requirements for resistance to functionally distinct DNA-damaging agents. Lee W, St Onge RP, Proctor M, Flaherty P, Jordan MI, Arkin AP, Davis RW, Nislow C, Giaever G PLoS Genet Aug. 1, 2005
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.