Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

UvrD

Protein FULL name:

DNA helicase II [Escherichia coli str. K-12 substr. MG1655].


UvrD (Escherichia coli strain K-12 substr. MG1655) is product of expression of uvrD gene.


UvrD is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     
NER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Has both ATPase and helicase activities. Unwinds DNA duplexes with 3' to 5' polarity with respect to the bound strand and initiates unwinding most effectively when a single-stranded region is present. Involved in the post-incision events of nucleotide excision repair and methyl-directed mismatch repair.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

INTERACTION: P0A9P0:lpdA; NbExp=1; IntAct=EBI-559573, EBI-542856; P25665:metE; NbExp=1; IntAct=EBI-559573, EBI-551247; P23367:mutL; NbExp=4; IntAct=EBI-559573, EBI-554913;

SIMILARITY: Belongs to the helicase family. UvrD subfamily.

SIMILARITY: Contains 1 uvrD-like helicase ATP-binding domain.

SIMILARITY: Contains 1 uvrD-like helicase C-terminal domain.


NCBI GenPept GI number(s): 148212
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P03018 P03018
PFAM: - P03018 (Link - using uniprot id)
InterPro: - P03018 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDVSYLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVE
NCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHXLAHRLLXA
HHMDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQK
DEGLRPHHIQSYGNPVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELW
LNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDTGKVMIVGDDD
QSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENN
NGRLGKKLWTDGADGEPISLYCAFNELDEARFVVNRIKTWQDNGGALAEC
AILYRSNAQSRVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIAN
RNDDAAFERVVNTPTRGIGDRTLDVVRQTSRDRQLTLWQACRELLQEKAL
AGRAASALQRFMELIDALAQETADMPLHVQTDRVIKDSGLRTMYEQEKGE
KGQTRIENLEELVTATRQFSYNEEDEDLMPLQAFLSHAALEAGEGQADTW
QDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAY
VGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGELPEECVEEVRLRATV
SRPVSHQRMGTPMVENDSGYKLGQRVRHAKFGEGTIVNMEGSGEHSRLQV
AFQGQGIKWLVAAYARLESV

References:

Title Authors Journal
Transcription of the uvrD gene of Escherichia coli is controlled by the lexA repressor and by attenuation. Easton AM, Kushner SR Nucleic Acids Res Dec. 20, 1983
The nucleotide sequence of the uvrD gene of E. coli. Finch PW, Emmerson PT Nucleic Acids Res July 25, 1984
Determination of the initiation sites of transcription and translation of the uvrD gene of Escherichia coli. Yamamoto Y, Ogawa T, Shinagawa H, Nakayama T, Matsuo H, Ogawa H J Biochem June 1, 1986
Recombination at ColE1 cer requires the Escherichia coli xerC gene product, a member of the lambda integrase family of site-specific recombinases. Colloms SD, Sykora P, Szatmari G, Sherratt DJ J Bacteriol Dec. 1, 1990
Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes. Daniels DL, Plunkett G 3rd, Burland V, Blattner FR Science Aug. 7, 1992
Characterization of DNA helicase II from a uvrD252 mutant of Escherichia coli. Washburn BK, Kushner SR J Bacteriol Feb. 1, 1993
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.