Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Sgs1p

Protein FULL name:

Nucleolar DNA helicase of the RecQ family involved in genome integrity maintenance; regulates chromosome synapsis and meiotic joint molecule/crossover formation; similar to human BLM and WRN proteins implicated in Bloom and Werner syndromes


Sgs1p (Saccharomyces cerevisiae) is product of expression of SGS1 gene.






FUNCTION: Interacts with topoisomerases II and TOP3. Could create a deleterious topological substrate that TOP3 preferentially resolves. The TOP3-SGS1 protein complex may function as a eukaryotic reverse gyrase introducing positive supercoils into extrachromosomal ribosomal DNA rings. Together with topoisomerase II has a role in chromosomal segregation. Maintains rDNA structure where it has a role in re-starting stalled replication forks.

SUBUNIT: Heterodimer with TOP3. Forms a complex with TOP3 and RMI1. Forms a ternary complex with a MLH1-MLH3 heterodimer (MutLbeta) during meiosis. Interacts with TOP2.

INTERACTION: Q12083:MLH3; NbExp=1; IntAct=EBI-17059, EBI-31634; Q12306:SMT3; NbExp=1; IntAct=EBI-17059, EBI-17490; P13099:TOP3; NbExp=1; IntAct=EBI-17059, EBI-19365;

SUBCELLULAR LOCATION: Nucleus, nucleolus.

SIMILARITY: Belongs to the helicase family. RecQ subfamily.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SIMILARITY: Contains 1 helicase C-terminal domain.

SIMILARITY: Contains 1 HRDC domain.


NCBI GenPept GI number(s): 6323844
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P35187 P35187
PFAM: - P35187 (Link - using uniprot id)
InterPro: - P35187 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MVTKPSHNLRREHKWLKETATLQEDKDFVFQAIQKHIANKRPKTNSPPTT
PSKDECGPGTTNFITSIPASGPTNTATKQHEVMQTLSNDTEWLSYTATSN
QYADVPMVDIPASTSVVSNPRTPNGSKTHNFNTFRPHMASSLVENDSSRN
LGSRNNNKSVIDNSSIGKQLENDIKLEVIRLQGSLIMALKEQSKLLLQKC
SIIESTSLSEDAKRLQLSRDIRPQLSNMSIRIDSLEKEIIKAKKDGMSKD
QSKGRSQVSSQDDNIISSILPSPLEYNTSSRNSNLTSTTATTVTKALAIT
GAKQNITNNTGKNSNNDSNNDDLIQVLDDEDDIDCDPPVILKEGAPHSPA
FPHLHMTSEEQDELTRRRNMRSREPVNYRIPDRDDPFDYVMGKSLRDDYP
DVEREEDELTMEAEDDAHSSYMTTRDEEKEENELLNQSDFDFVVNDDLDP
TQDTDYHDNMDVSANIQESSQEGDTRSTITLSQNKNVQVILSSPTAQSVP
SNGQNQIGVEHIDLLEDDLEKDAILDDSMSFSFGRQHMPMSHSDLELIDS
EKENEDFEEDNNNNGIEYLSDSDLERFDEERENRTQVADIQELDNDLKII
TERKLTGDNEHPPPSWSPKIKREKSSVSQKDEEDDFDDDFSLSDIVSKSN
LSSKTNGPTYPWSDEVLYRLHEVFKLPGFRPNQLEAVNATLQGKDVFVLM
PTGGGKSLCYQLPAVVKSGKTHGTTIVISPLISLMQDQVEHLLNKNIKAS
MFSSRGTAEQRRQTFNLFINGLLDLVYISPEMISASEQCKRAISRLYADG
KLARIVVDEAHCVSNWGHDFRPDYKELKFFKREYPDIPMIALTATASEQV
RMDIIHNLELKEPVFLKQSFNRTNLYYEVNKKTKNTIFEICDAVKSRFKN
QTGIIYCHSKKSCEQTSAQMQRNGIKCAYYHAGMEPDERLSVQKAWQADE
IQVICATVAFGMGIDKPDVRFVYHFTVPRTLEGYYQETGRAGRDGNYSYC
ITYFSFRDIRTMQTMIQKDKNLDRENKEKHLNKLQQVMAYCDNVTDCRRK
LVLSYFNEDFDSKLCHKNCDNCRNSANVINEERDVTEPAKKIVKLVESIQ
NERVTIIYCQDVFKGSRSSKIVQANHDTLEEHGIGKSMQKSEIERIFFHL
ITIRVLQEYSIMNNSGFASSYVKVGPNAKKLLTGKMEIKMQFTISAPNSR
PSTSSSFQANEDNIPVIAQKSTTIGGNVAANPPRFISAKEHLRSYTYGGS
TMGSSHPITLKNTSDLRSTQELNNLRMTYERLRELSLNLGNRMVPPVGNF
MPDSILKKMAAILPMNDSAFATLGTVEDKYRRRFKYFKATIADLSKKRSS
EDHEKYDTILNDEFVNRAAASSNGIAQSTGTKSKFFGANLNEAKENEQII
NQIRQSQLPKNTTSSKSGTRSISKSSKKSANGRRGFRNYRGHYRGRK

Sgs1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The yeast type I topoisomerase Top3 interacts with Sgs1, a DNA helicase homolog: a potential eukaryotic reverse gyrase. Gangloff S, McDonald JP, Bendixen C, Arthur L, Rothstein R Mol Cell Biol Dec. 1, 1994
Sgs1: a eukaryotic homolog of E. coli RecQ that interacts with topoisomerase II in vivo and is required for faithful chromosome segregation. Watt PM, Louis EJ, Borts RH, Hickson ID Cell April 21, 1995
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature May 1, 1997
The three-dimensional structure of the HRDC domain and implications for the Werner and Bloom syndrome proteins. Liu Z, Macias MJ, Bottomley MJ, Stier G, Linge JP, Nilges M, Bork P, Sattler M Structure Dec. 15, 1999
Supercomplex formation between Mlh1-Mlh3 and Sgs1-Top3 heterocomplexes in meiotic yeast cells. Wang TF, Kung WM Biochem Biophys Res Commun Aug. 1, 2002
Role of SGS1 and SLX4 in maintaining rDNA structure in Saccharomyces cerevisiae. Kaliraman V, Brill SJ Curr Genet Sept. 1, 2002
RMI1/NCE4, a suppressor of genome instability, encodes a member of the RecQ helicase/Topo III complex. Chang M, Bellaoui M, Zhang C, Desai R, Morozov P, Delgado-Cruzata L, Rothstein R, Freyer GA, Boone C, Brown GW EMBO J June 1, 2005
Yeast Rmi1/Nce4 controls genome stability as a subunit of the Sgs1-Top3 complex. Mullen JR, Nallaseth FS, Lan YQ, Slagle CE, Brill SJ Mol Cell Biol June 1, 2005


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.