Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Tfb4p

Protein FULL name:

Subunit of TFIIH complex, involved in transcription initiation, similar to 34 kDa subunit of human TFIIH; interacts with Ssl1p


Tfb4p (Saccharomyces cerevisiae) is product of expression of TFB4 gene.






FUNCTION: Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro.

SUBUNIT: Component of the TFIIH core complex, which is composed of RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.

SUBCELLULAR LOCATION: Nucleus (By similarity).

SIMILARITY: Belongs to the TFB4 family.


This protein can be a part of a given complexes:
NCBI GenPept GI number(s): 6325313
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12004 Q12004
PFAM: - Q12004 (Link - using uniprot id)
InterPro: - Q12004 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSI
IKVLEALIVFLNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESE
NKTRSDLKIINSDMYRRFRNVDETLVEEIYKLFELEKKQIEQNSQRSTLA
GAMSAGLTYVNRISKESVTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCI
FSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVESTEGLIQYLAT
AMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIP
PGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKKKVTKP

Tfb4p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
RNA polymerase transcription factor IIH holoenzyme from yeast. Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD J Biol Chem Nov. 11, 1994
Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair. Sung P, Guzder SN, Prakash L, Prakash S J Biol Chem May 3, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature May 1, 1997
Genes for Tfb2, Tfb3, and Tfb4 subunits of yeast transcription/repair factor IIH. Homology to human cyclin-dependent kinase activating kinase and IIH subunits. Feaver WJ, Henry NL, Wang Z, Wu X, Svejstrup JQ, Bushnell DA, Friedberg EC, Kornberg RD J Biol Chem Aug. 1, 1997
The TFB4 subunit of yeast TFIIH is required for both nucleotide excision repair and RNA polymerase II transcription. Feaver WJ, Huang W, Friedberg EC J Biol Chem Oct. 8, 1999
Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH. Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD J Biol Chem Nov. 7, 2003


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.