Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

DNA ligase

Protein FULL name:

NAD-dependent DNA ligase [Escherichia coli UTI89].


DNA ligase (Escherichia coli strain K-12 substr. MG1655) is product of expression of ligA gene.


DNA ligase is involved in:

MMR in Escherichia coli strain K-12 substr. MG1655 BER in Escherichia coli strain K-12 substr. MG1655 NER in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double-stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA.

CATALYTIC ACTIVITY: NAD(+) + (deoxyribonucleotide)(n) + (deoxyribonucleotide)(m) = AMP + nicotinamide nucleotide + (deoxyribonucleotide)(n+m).

COFACTOR: Magnesium.

SIMILARITY: Belongs to the NAD-dependent DNA ligase family. LigA subfamily.

SIMILARITY: Contains 1 BRCT domain.


NCBI GenPept GI number(s): 91211748
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P15042 P15042
PFAM: - P15042 (Link - using uniprot id)
InterPro: - P15042 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHP
ELITPDSPTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQD
RLKSNEKVTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVR
TIRAIPLKLHGENIPARLEVRGEVFLPQAGFEKINEDARRTGGKVFANPR
NAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGELPDTHLGRLMQFKAWG
LPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQL
GFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAG
VLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTR
EVVFPTHCPVCGSDVERVEGEAVARCTGGLICGAQRKESLKHFVSRRAMD
VDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNAL
EKAKETTFARFLYALGVREVGEATAAGLAAYFGTLEALEAASIEELQKVP
DVGIVVASHVHNFFAEESNRNVISELLAEGVHWPEPIVINAEEIDSPFAG
KTVVLTGSLSQMSRDDAKARLVELGAKVAGSVSKKTDLVIAGEAAGSKLA
KAQELGIEVIDETEMLRLLGS


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.