Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

PolII

Protein FULL name:

DNA polymerase II [Escherichia coli].


PolII (Escherichia coli strain K-12 substr. MG1655) is product of expression of polB gene.


PolII is involved in:

TLS in Escherichia coli strain K-12 substr. MG1655
     
DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Thought to be involved in DNA repair and/or mutagenesis.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

ENZYME REGULATION: DNA polymerase II activity is regulated by the lexA gene during the SOS response.

INTERACTION: P0AC41:sdhA; NbExp=1; IntAct=EBI-1113379, EBI-371263;

SIMILARITY: Belongs to the DNA polymerase type-B family.


NCBI GenPept GI number(s): 147318
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P21189 P21189
PFAM: - P21189 (Link - using uniprot id)
InterPro: - P21189 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFIPADQV
PRAQHILQGEQGFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGG
VTVYEADVRPPERYLMERFITSPVWVEGDMHNGTIVNARLKPHPDYRPPL
KWVSIDIETTRHGELYCIGLEACGQRIVYMLGPENGDASSLDFELEYVAS
RPQLLEKLNAWFANYDPDVIIGWNVVQFDLRMLQKHAERYRLPLRLGRDN
SELEWREHGFKNGVFFAQAKGRLIIDGIEALKSAFWNFSSFSLETVAQEL
LGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVTQIFHKTEIMP
FLLERATVNGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHASP
GGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHS
TEGFLDAWFSREKHCLPEIVTNIWHGRDEAKRQGNKPLSQALKIIMNAFY
GVLGTTACRFFDPRLASSITMRGHQIMRQTKALIEAQGYDVIYGDTDSTF
VWLKGAHSEEEAAKIGRALVQHVNAWWAETLQKQRLTSALELEYETHFCR
FLMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLETVRTDWTPLAQQFQQ
ELYLRIFRNEPYQEYVRETIDKLMAGELDARLVYRKRLRRPLSEYQRNVP
PHVRAARLADEENQKRGRPLQYQNRGTIKYVWTTTGPEPPGLPTFTTGLR
TLSDPPATTRGGGNTPFY

PolII (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
PolII (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:

Title Authors Journal
DNA polymerase II is encoded by the DNA damage-inducible dinA gene of Escherichia coli. Bonner CA, Hays S, McEntee K, Goodman MF Proc Natl Acad Sci U S A Oct. 1, 1990
Nucleotide sequence and deletion analysis of the polB gene of Escherichia coli. Chen H, Sun Y, Stark T, Beattie W, Moses RE DNA Cell Biol Nov. 1, 1990
Escherichia coli DNA polymerase II is homologous to alpha-like DNA polymerases. Iwasaki H, Ishino Y, Toh H, Nakata A, Shinagawa H Mol Gen Genet April 1, 1991
Systematic sequencing of the Escherichia coli genome: analysis of the 0-2.4 min region. Yura T, Mori H, Nagai H, Nagata T, Ishihama A, Fujita N, Isono K, Mizobuchi K, Nakata A Nucleic Acids Res July 11, 1992
The Escherichia coli polB locus is identical to dinA, the structural gene for DNA polymerase II. Characterization of Pol II purified from a polB mutant. Qiu Z, Goodman MF J Biol Chem March 28, 1997
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: July 7, 2011.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.