Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
LexA |
Protein FULL name:
LexA repressor.
LexA (Escherichia coli strain K-12 substr. MG1655) is product of expression of lexA gene.
LexA is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, recA interacts with lexA causing an autocatalytic cleavage which disrupts the DNA-binding part of lexA, leading to derepression of the SOS regulon and eventually DNA repair (By similarity).
CATALYTIC ACTIVITY: Hydrolysis of Ala-|-Gly bond in repressor lexA.
SUBUNIT: Homodimer (By similarity).
SIMILARITY: Belongs to the peptidase S24 family.
| NCBI GenPept GI number(s): |
67467382 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A7C3 |
P0A7C3 |
| PFAM: |
PF01726 PF00717 |
PF01726 PF00717 |
| InterPro: |
IPR006199 IPR006200 IPR006197 IPR019759 IPR015927 IPR011056 IPR011991 |
IPR006199 IPR006200 IPR006197 IPR019759 IPR015927 IPR011056 IPR011991 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKAL ARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQV DPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARID DEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGD WL |
LexA (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:
| Title | Authors | Journal |
| Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli. | Welch RA, Burland V, Plunkett G 3rd, Redford P, Roesch P, Rasko D, Buckles EL, Liou SR, Boutin A, Hackett J, Stroud D, Mayhew GF, Rose DJ, Zhou S, Schwartz DC, Perna NT, Mobley HL, Donnenberg MS, Blattner FR | Proc Natl Acad Sci U S A Dec. 24, 2002 |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|