Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

LexA

Protein FULL name:

LexA repressor.


LexA (Escherichia coli strain K-12 substr. MG1655) is product of expression of lexA gene.


LexA is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, recA interacts with lexA causing an autocatalytic cleavage which disrupts the DNA-binding part of lexA, leading to derepression of the SOS regulon and eventually DNA repair (By similarity).

CATALYTIC ACTIVITY: Hydrolysis of Ala-|-Gly bond in repressor lexA.

SUBUNIT: Homodimer (By similarity).

SIMILARITY: Belongs to the peptidase S24 family.


NCBI GenPept GI number(s): 67467382
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A7C3 P0A7C3
PFAM: PF01726
PF00717
PF01726
PF00717
InterPro: IPR006199
IPR006200
IPR006197
IPR019759
IPR015927
IPR011056
IPR011991
IPR006199
IPR006200
IPR006197
IPR019759
IPR015927
IPR011056
IPR011991
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKAL
ARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQV
DPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARID
DEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGD
WL

LexA (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:

Title Authors Journal
Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli. Welch RA, Burland V, Plunkett G 3rd, Redford P, Roesch P, Rasko D, Buckles EL, Liou SR, Boutin A, Hackett J, Stroud D, Mayhew GF, Rose DJ, Zhou S, Schwartz DC, Perna NT, Mobley HL, Donnenberg MS, Blattner FR Proc Natl Acad Sci U S A Dec. 24, 2002


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.