Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

UmuD

Protein FULL name:

UmuD [Escherichia coli].


UmuD (Escherichia coli strain K-12 substr. MG1655) is product of expression of umuD gene.


UmuD is involved in:

TLS in Escherichia coli strain K-12 substr. MG1655
     
DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Involved in UV protection and mutation. Essential for induced (or SOS) mutagenesis. May modify the DNA replication machinery to allow bypass synthesis across a damaged template.

SIMILARITY: Belongs to the peptidase S24 family.


NCBI GenPept GI number(s): 85376582
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0AG11 P0AG11
PFAM: - P0AG11 (Link - using uniprot id)
InterPro: - P0AG11 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSA
TYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQ
LRPTVQLTPMNSAYSPITISSEDTLDVFGVVIHVVKAMR

UmuD (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
UmuD (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:

Title Authors Journal
Structural analysis of the umu operon required for inducible mutagenesis in Escherichia coli. Kitagawa Y, Akaboshi E, Shinagawa H, Horii T, Ogawa H, Kato T Proc Natl Acad Sci U S A July 1, 1985
umuDC and mucAB operons whose products are required for UV light- and chemical-induced mutagenesis: UmuD, MucA, and LexA proteins share homology. Perry KL, Elledge SJ, Mitchell BB, Marsh L, Walker GC Proc Natl Acad Sci U S A July 1, 1985
Escherichia coli umuDC mutants: DNA sequence alterations and UmuD cleavage. Koch WH, Ennis DG, Levine AS, Woodgate R Mol Gen Genet June 1, 1992
Structure of the UmuD' protein and its regulation in response to DNA damage. Peat TS, Frank EG, McDonald JP, Levine AS, Woodgate R, Hendrickson WA Nature April 25, 1996
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res June 1, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.