REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

UmuC

Protein FULL name:

UmuC [Escherichia coli].


UmuC (Escherichia coli strain K-12 substr. MG1655) is product of expression of umuC gene.


UmuC is involved in:

TLS in Escherichia coli strain K-12 substr. MG1655
     
DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Involved in UV protection and mutation. Essential for induced (or SOS) mutagenesis. May modify the DNA replication machinery to allow bypass synthesis across a damaged template.

INTERACTION: P0AFY8:seqA; NbExp=1; IntAct=EBI-1119849, EBI-552553;

SIMILARITY: Belongs to the DNA polymerase type-Y family.

SIMILARITY: Contains 1 umuC domain.


NCBI GenPept GI number(s): 84060801
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P04152 P04152
PFAM: - P04152 (Link - using uniprot id)
InterPro: - P04152 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MLALTLGNIRRTEKLLSLQPVEEIWGVGRRISKKLNTMGITTALQLARAT
PVFIRKNFNVVLERTVRELTGESCISLEEAPPPKQQIVCSRSFGERVTTY
EAMRQAVCQYAERAAEKLRGERQFCRHIAVFVKTSPFAVNEPYYGNMASE
KLLIPTQDTQDIIAAAVRALDRIWVDGHRYAKAGCMLNDFAPDGVSLLNP
VR

References:

Title Authors Journal
Structural analysis of the umu operon required for inducible mutagenesis in Escherichia coli. Kitagawa Y, Akaboshi E, Shinagawa H, Horii T, Ogawa H, Kato T Proc Natl Acad Sci U S A July 1, 1985
umuDC and mucAB operons whose products are required for UV light- and chemical-induced mutagenesis: UmuD, MucA, and LexA proteins share homology. Perry KL, Elledge SJ, Mitchell BB, Marsh L, Walker GC Proc Natl Acad Sci U S A July 1, 1985
Escherichia coli umuDC mutants: DNA sequence alterations and UmuD cleavage. Koch WH, Ennis DG, Levine AS, Woodgate R Mol Gen Genet June 1, 1992
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res June 1, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.