Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

UvrB

Protein FULL name:

UvrABC system protein B, Excinuclease ABC subunit B.,


Protein SHORT name:

uvrB


UvrB (Escherichia coli strain K-12 substr. MG1655) is product of expression of uvrB gene.


UvrB is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     
NER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 uvrA and 2 uvrB subunits scans DNA for abnormalities. Upon binding of the uvrA(2)B(2) complex to a putative damaged site, the DNA wraps around one uvrB monomer. DNA wrap is dependent on ATP binding by uvrB and probably causes local melting of the DNA helix, facilitating insertion of uvrB beta-hairpin between the DNA strands. Then uvrB probes one DNA strand for the presence of a lesion. If a lesion is found the uvrA subunits dissociate and the uvrB-DNA preincision complex is formed. This complex is subsequently bound by uvrC and the second uvrB is released. If no lesion is found, the DNA wraps around the other uvrB subunit that will check the other stand for damage.

SUBUNIT: Forms a heterotetramer with uvrA during the search for lesions. Interacts with uvrC in an incision complex.

SUBCELLULAR LOCATION: Cytoplasm.

DOMAIN: The beta-hairpin motif is involved in DNA binding.

MISCELLANEOUS: According to PubMed:3515321, a cleaved form of the protein was observed that resulted from the removal of about 40 amino acids from the C-terminus of the protein. The exact cleavage site being unknown, it was proposed to be between Lys-630 and Ala- 631. There was no indication that cleavage occured in vivo and therefore it is not known if it has any physiological significance.

SIMILARITY: Belongs to the uvrB family.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SIMILARITY: Contains 1 helicase C-terminal domain.

SIMILARITY: Contains 1 UVR domain.


NCBI GenPept GI number(s): 67474768
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A8F8 P0A8F8
PFAM: PF00271
PF04851
PF02151
PF00271
PF04851
PF02151
InterPro: IPR014001
IPR001650
IPR014021
IPR006935
IPR001943
IPR004807
IPR009055
IPR014001
IPR001650
IPR014021
IPR006935
IPR001943
IPR004807
IPR009055
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSKPFKLNSAFKPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIA
NVIADLQRPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEA
YVPSSDTFIEKDASVNEHIEQMRLSATKAMLERRDVVVVASVSAIYGLGD
PDLYLKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRVRGEVI
DIFPAESDDIALRVELFDEEVERLSLFDPLTGQIVSTIPRFTIYPKTHYV
TPRERIVQAMEEIKEELAARRKVLLENNKLLEEQRLTQRTQFDLEMMNEL
GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVVDESHVTIPQIGGM
YRGDRARKETLVEYGFRLPSALDNRPLKFEEFEALAPQTIYVSATPGNYE
LEKSGGDVVDQVVRPTGLLDPIIEVRPVATQVDDLLSEIRQRAAINERVL
VTTLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERMEIIRDLRLGEFDVL
VGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIGRAARNVNGKA
ILYGDKITPSMAKAIGETERRREKQQKYNEEHGITPQGLNKKVVDILALG
QNIAKTKAKGRGKSRPIVEPDNVPMDMSPKALQQKIHELEGLMMQHAQNL
EFEEAAQIRDQLHQLRELFIAAS

References:

Title Authors Journal
Sequences of the E. coli uvrB gene and protein. Arikan E, Kulkarni MS, Thomas DC, Sancar A. Nucleic Acids Res. March 25, 1986
Structure of the uvrB gene of Escherichia coli. Homology with other DNA repair enzymes and characterization of the uvrB5 mutation. Backendorf C, Spaink H, Barbeiro AP, van de Putte P Nucleic Acids Res April 11, 1986
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res June 1, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
NMR assignments and secondary structure of the UvrC binding domain of UvrB. Alexandrovich A, Sanderson MR, Moolenaar GF, Goosen N, Lane AN FEBS Lett May 21, 1999
Crystal structure of Escherichia coli UvrB C-terminal domain, and a model for UvrB-uvrC interaction. Sohi M, Alexandrovich A, Moolenaar G, Visse R, Goosen N, Vernede X, Fontecilla-Camps JC, Champness J, Sanderson MR FEBS Lett Feb. 14, 2000
Clue to damage recognition by UvrB: residues in the beta-hairpin structure prevent binding to non-damaged DNA. Moolenaar GF, Hoglund L, Goosen N EMBO J Nov. 1, 2001
The presence of two UvrB subunits in the UvrAB complex ensures damage detection in both DNA strands. Verhoeven EE, Wyman C, Moolenaar GF, Goosen N EMBO J Aug. 1, 2002
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.