Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

UvrC

Protein FULL name:

UvrABC system protein C, Excinuclease ABC subunit C.,


Protein SHORT name:

uvrC


UvrC (Escherichia coli strain K-12 substr. MG1655) is product of expression of uvrC gene.


UvrC is involved in:

NER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision (By similarity).

SUBUNIT: Interacts with uvrB in an incision complex (By similarity).

SUBCELLULAR LOCATION: Cytoplasm (By similarity).

SIMILARITY: Belongs to the uvrC family.

SIMILARITY: Contains 1 UVR domain.


NCBI GenPept GI number(s): 189038049
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot A1AC65 A1AC65
PFAM: PF01541
PF00633
PF02151
PF08459
PF01541
PF00633
PF02151
PF08459
InterPro: IPR000445
IPR003583
IPR010994
IPR001943
IPR009055
IPR004791
IPR001162
IPR000305
IPR000445
IPR003583
IPR010994
IPR001943
IPR009055
IPR004791
IPR001162
IPR000305
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSDQFDAKAFLKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSN
LASRKTEALVAQIQQIDVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDK
SYPFIFLSGDTHPRLAMHRGAKHAKGEYFGPFPNGYAVRETLALLQKIFP
IRQCENSVYRNRSRPCLQYQIGRCLGPCVEGLVSEEEYAQQVEYVRLFLS
GKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQFVSNTGD
DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGSTELSEVVETFV
GQFYLQGSQMRTLPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGD
RARYLKLARTNAATALTSKLSQQSTVHQRLTALASVLKLPEVKRMECFDI
SHTMGEQTVASCVVFDANGPLRAEYRRYNITGITPGDDYAAMNQVLRRRY
GKAIDDSKIPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGA
DRKAGLETLFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRA
KVKNTSSLETIEGIGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGL
AEKIFWSLKH

References:

Title Authors Journal
The genome sequence of avian pathogenic Escherichia coli strain O1:K1:H7 shares strong similarities with human extraintestinal pathogenic E. coli genomes. Johnson TJ, Kariyawasam S, Wannemuehler Y, Mangiamele P, Johnson SJ, Doetkott C, Skyberg JA, Lynne AM, Johnson JR, Nolan LK J Bacteriol April 1, 2007


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.