Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nei

Protein FULL name:

5-formyluracil/5-hydroxymethyluracil DNA glycosylase [Escherichia coli str. K-12 substr. MG1655].


Nei (Escherichia coli strain K-12 substr. MG1655) is product of expression of nei gene.


Nei is involved in:

BER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'- phosphates.

CATALYTIC ACTIVITY: Removes damaged bases from DNA, leaving an abasic site.

CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

COFACTOR: Binds 1 zinc ion per subunit.

SIMILARITY: Belongs to the FPG family.

SIMILARITY: Contains 1 FPG-type zinc finger.


NCBI GenPept GI number(s): 16128689
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P50465 P50465
PFAM: - P50465 (Link - using uniprot id)
InterPro: - P50465 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MPEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKPYQSQLIGQHVTHVET
RGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKT
ILLYSASDIEMLTPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFR
NRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAH
ALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERCGSIIEKTTL
SSRPFYWCPGCQH


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.