Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nfo

Protein FULL name:

endonuclease IV with intrinsic 3'-5' exonuclease activity [Escherichia coli str. K-12 substr. MG1655].


Nfo (Escherichia coli strain K-12 substr. MG1655) is product of expression of nfo gene.


Nfo is involved in:

BER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-phosphate residues. It preferentially attacks modified AP sites created by bleomycin and neocarzinostatin.

CATALYTIC ACTIVITY: Endonucleolytic cleavage to 5'- phosphooligonucleotide end-products.

COFACTOR: Binds 3 zinc ions. Can also bind manganese.

SUBUNIT: Monomer.

INDUCTION: Endonuclease IV is induced by agents which generate superoxide radical anions.

SIMILARITY: Belongs to the AP endonuclease 2 family.


NCBI GenPept GI number(s): 16130097
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A6C1 P0A6C1
PFAM: - P0A6C1 (Link - using uniprot id)
InterPro: - P0A6C1 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTID
EFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQ
LGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQ
GSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTF
ADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQD
DRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA

Nfo (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:

Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.