Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecB

Protein FULL name:

exonuclease V (RecBCD complex), beta subunit [Escherichia coli str. K-12 substr. MG1655].


RecB (Escherichia coli strain K-12 substr. MG1655) is product of expression of recB gene.


RecB is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Required for efficient DNA repair; it catalyzes the unwinding of double-stranded DNA and the cleavage of single- stranded DNA and it stimulates local genetic recombination. All of these activities require concomitant hydrolysis of ATP.

CATALYTIC ACTIVITY: Exonucleolytic cleavage (in the presence of ATP) in either 5'- to 3'- or 3'- to 5'-direction to yield 5'- phosphooligonucleotides.

SUBUNIT: Consist of three subunits; recB, recC and recD.

SIMILARITY: Belongs to the helicase family. UvrD subfamily.

SIMILARITY: Contains 1 uvrD-like helicase ATP-binding domain.

SIMILARITY: Contains 1 uvrD-like helicase C-terminal domain.


NCBI GenPept GI number(s): 16130724
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P08394 P08394
PFAM: - P08394 (Link - using uniprot id)
InterPro: - P08394 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSDVAETLDPLRLPLQGERLIEASAGTGKTFTIAALYLRLLLGLGGSAAF
PRPLTVEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERL
LEEIDDKAQAAQWLLLAERQMDEAAVFTIHGFCQRMLNLNAFESGMLFEQ
QLIEDESLLRYQACADFWRRHCYPLPREIAQVVFETWKGPQALLRDINRY
LQGEAPVIKAPPPDDETLASRHAQIVARIDTVKQQWRDAVGELDALIESS
GIDRRKFNRSNQAKWIDKISAWAEEETNSYQLPESLEKFSQRFLEDRTKA
GGETPRHPLFEAIDQLLAEPLSIRDLVITRALAEIRETVAREKRRRGELG
FDDMLSRLDSALRSESGEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRI
WHHQPETALLLIGDPKQAIYAFRGADIFTYMKARSEVHAHYTLDTNWRSA
PGMVNSVNKLFSQTDDAFMFREIPFIPVKSAGKNQALRFVFKGETQPAMK
MWLMEGESCGVGDYQSTMAQVCAAQIRDWLQAGQRGEALLMNGDDARPVR
ASDISVLVRSRQEAAQVRDALTLLEIPSVYLSNRDSVFETLEAQEMLWLL
QAVMTPERENTLRSALATSMMGLNALDIETLNNDEHAWDVVVEEFDGYRQ
IWRKRGVMPMLRALMSARNIAENLLATAGGERRLTDILHISELLQEAGTQ
LESEHALVRWLSQHILEPDSNASSQQMRLESDKHLVQIVTIHKSKGLEYP
LVWLPFITNFRVQEQAFYHDRHSFEAVLDLNAAPESVDLAEAERLAEDLR
LLYVALTRSVWHCSLGVAPLVRRRGDKKGDTDVHQSALGRLLQKGEPQDA
AGLRTCIEALCDDDIAWQTAQTGDNQPWQVNDVSTAELNAKTLQRLPGDN
WRVTSYSGLQQRGHGIAQDLMPRLDVDAAGVASVVEEPTLTPHQFPRGAS
PGTFLHSLFEDLDFTQPVDPNWVREKLELGGFESQWEPVLTEWITAVLQA
PLNETGVSLSQLSARNKQVEMEFYLPISEPLIASQLDTLIRQFDPLSAGC
PPLEFMQVRGMLKGFIDLVFRHEGRYYLLDYKSNWLGEDSSAYTQQAMAA
AMQAHRYDLQYQLYTLALHRYLRHRIADYDYEHHFGGVIYLFLRGVDKEH
PQQGIYTTRPNAGLIALMDEMFAGMTLEEA

References:

Title Authors Journal
Complete nucleotide sequence of the Escherichia coli ptr gene encoding protease III. Finch PW, Wilson RE, Brown K, Hickson ID, Emmerson PT Nucleic Acids Res Oct. 10, 1986
Complete nucleotide sequence of the Escherichia coli recB gene. Finch PW, Storey A, Chapman KE, Brown K, Hickson ID, Emmerson PT Nucleic Acids Res Nov. 11, 1986
Complete nucleotide sequence of recD, the structural gene for the alpha subunit of Exonuclease V of Escherichia coli. Finch PW, Storey A, Brown K, Hickson ID, Emmerson PT Nucleic Acids Res Nov. 11, 1986
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Facilitated loading of RecA protein is essential to recombination by RecBCD enzyme. Arnold DA, Kowalczykowski SC J Biol Chem April 21, 2000
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.