Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecC

Protein FULL name:

exonuclease V (RecBCD complex), gamma chain [Escherichia coli str. K-12 substr. MG1655].


RecC (Escherichia coli strain K-12 substr. MG1655) is product of expression of recC gene.


RecC is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655




FUNCTION: Exhibits a wide variety of catalytic activities including ATP-dependent exonuclease, ATP-stimulated endonuclease, ATP-dependent helicase and DNA-dependent ATPase activities.

CATALYTIC ACTIVITY: Exonucleolytic cleavage (in the presence of ATP) in either 5'- to 3'- or 3'- to 5'-direction to yield 5'- phosphooligonucleotides.

SUBUNIT: Consist of three subunits; recB, recC and recD.

INTERACTION: P0A698:uvrA; NbExp=1; IntAct=EBI-556823, EBI-552091;


NCBI GenPept GI number(s): 16130726
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P07648 P07648
PFAM: - P07648 (Link - using uniprot id)
InterPro: - P07648 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQWLQMTL
SQKFGIAANIDFPLPASFIWDMFVRVLPEIPKESAFNKQSMSWKLMTLLP
QLLEREDFTLLRHYLTDDSDKRKLFQLSSKAADLFDQYLVYRPDWLAQWE
TGHLVEGLGEAQAWQAPLWKALVEYTHQLGQPRWHRANLYQRFIETLESA
TTCPPGLPSRVFICGISALPPVYLQALQALGKHIEIHLLFTNPCRYYWGD
IKDPAYLAKLLTRQRRHSFEDRELPLFRDSENAGQLFNSDGEQDVGNPLL
ASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQSDILELENRAV
AGVNIEEFSRSDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEED
PTLTPRDIIVMVADIDSYSPFIQAVFGSAPADRYLPYAISDRRARQSHPV
LEAFISLLSLPDSRFVSEDVLALLDVPVLAARFDITEEGLRYLRQWVNES
GIRWGIDDDNVRELELPATGQHTWRFGLTRMLLGYAMESAQGEWQSVLPY
DESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCRDMLNAFFL
PDAETEAAMTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDELAQRLDQERI
SQRFLAGPVNICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLGFDLMSQK
PKRGDRSRRDDDRYLFLEALISAQQKLYISYIGRSIQDNSERFPSVLVQE
LIDYIGQSHYLPGDEALNCDESEARVKAHLTCLHTRMPFDPQNYQPGERQ
SYAREWLPAASQAGKAHSEFVQPLPFTLPETVPLETLQRFWAHPVRAFFQ
MRLQVNFRTEDSEIPDTEPFILEGLSRYQINQQLLNALVEQDDAERLFRR
FRAAGDLPYGAFGEIFWETQCQEMQQLADRVIACRQPGQSMEIDLACNGV
QITGWLPQVQPDGLLRWRPSLLSVAQGMQLWLEHLVYCASGGNGESRLFL
RKDGEWRFPPLAAEQALHYLSQLIEGYREGMSAPLLVLPESGGAWLKTCY
DAQNDAMLDDDSTLQKARTKFLQAYEGNMMVRGEGDDIWYQRLWRQLTPE
TMEAIVEQSQRFLLPLFRFNQS

References:

Title Authors Journal
Complete nucleotide sequence of the Escherichia coli recC gene and of the thyA-recC intergenic region. Finch PW, Wilson RE, Brown K, Hickson ID, Tomkinson AE, Emmerson PT Nucleic Acids Res June 11, 1986
Complete nucleotide sequence of the Escherichia coli ptr gene encoding protease III. Finch PW, Wilson RE, Brown K, Hickson ID, Emmerson PT Nucleic Acids Res Oct. 10, 1986
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.