Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecD |
Protein FULL name:
exonuclease V (RecBCD complex), alpha chain [Escherichia coli str. K-12 substr. MG1655].
RecD (Escherichia coli strain K-12 substr. MG1655) is product of expression of recD gene.
RecD is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- RecBCD resect DNA in 5' to 3' direction in Escherichia coli strain K-12 substr. MG1655
- RecA joins and starts the filament formation in Escherichia coli strain K-12 substr. MG1655
FUNCTION: Exhibits several catalytic activities, including ATP- dependent exonuclease, ATP-stimulated endonuclease, ATP-dependent unwinding and DNA-dependent ATPase activities. Strand cleavage occurs 5' to 3' during the unwinding of duplex DNA at CHI sequences, which locally stimulate recombination.
CATALYTIC ACTIVITY: Exonucleolytic cleavage (in the presence of ATP) in either 5'- to 3'- or 3'- to 5'-direction to yield 5'- phosphooligonucleotides.
SUBUNIT: Consist of three subunits; recB, recC and recD.
SIMILARITY: Belongs to the recD family.
| NCBI GenPept GI number(s): |
16130723 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P04993 |
P04993 |
| PFAM: | - |
P04993 (Link - using uniprot id) |
| InterPro: | - |
P04993 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGH VCLPLSRLENNEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPM ILCGDRLYLNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVSDE INWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIR LAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTLHRLLGAQPGS QRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQ LASVEAGAVLGDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRD SLCLLQKSYRFGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQS GEDYIAMLEEALAGYGRYLDLLQARAEPDLIIQAFNEYQLLCALREGPFG VAGLNERIEQFMQQKRKIHRHPHSRWYEGRPVMIARNDSALGLFNGDIGI ALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHKSQGSEFDHAA LILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL AALFSSRE |
References:
| Title | Authors | Journal |
| Complete nucleotide sequence of the Escherichia coli recB gene. | Finch PW, Storey A, Chapman KE, Brown K, Hickson ID, Emmerson PT | Nucleic Acids Res Nov. 11, 1986 |
| Complete nucleotide sequence of recD, the structural gene for the alpha subunit of Exonuclease V of Escherichia coli. | Finch PW, Storey A, Brown K, Hickson ID, Emmerson PT | Nucleic Acids Res Nov. 11, 1986 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|