Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecD

Protein FULL name:

exonuclease V (RecBCD complex), alpha chain [Escherichia coli str. K-12 substr. MG1655].


RecD (Escherichia coli strain K-12 substr. MG1655) is product of expression of recD gene.


RecD is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655




FUNCTION: Exhibits several catalytic activities, including ATP- dependent exonuclease, ATP-stimulated endonuclease, ATP-dependent unwinding and DNA-dependent ATPase activities. Strand cleavage occurs 5' to 3' during the unwinding of duplex DNA at CHI sequences, which locally stimulate recombination.

CATALYTIC ACTIVITY: Exonucleolytic cleavage (in the presence of ATP) in either 5'- to 3'- or 3'- to 5'-direction to yield 5'- phosphooligonucleotides.

SUBUNIT: Consist of three subunits; recB, recC and recD.

SIMILARITY: Belongs to the recD family.


NCBI GenPept GI number(s): 16130723
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P04993 P04993
PFAM: - P04993 (Link - using uniprot id)
InterPro: - P04993 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGH
VCLPLSRLENNEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPM
ILCGDRLYLNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVSDE
INWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIR
LAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTLHRLLGAQPGS
QRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQ
LASVEAGAVLGDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRD
SLCLLQKSYRFGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQS
GEDYIAMLEEALAGYGRYLDLLQARAEPDLIIQAFNEYQLLCALREGPFG
VAGLNERIEQFMQQKRKIHRHPHSRWYEGRPVMIARNDSALGLFNGDIGI
ALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHKSQGSEFDHAA
LILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL
AALFSSRE

References:

Title Authors Journal
Complete nucleotide sequence of the Escherichia coli recB gene. Finch PW, Storey A, Chapman KE, Brown K, Hickson ID, Emmerson PT Nucleic Acids Res Nov. 11, 1986
Complete nucleotide sequence of recD, the structural gene for the alpha subunit of Exonuclease V of Escherichia coli. Finch PW, Storey A, Brown K, Hickson ID, Emmerson PT Nucleic Acids Res Nov. 11, 1986
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.