Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

DnaT

Protein FULL name:

DNA biosynthesis protein (primosomal protein I) [Escherichia coli str. K-12 substr. MG1655].


DnaT (Escherichia coli strain K-12 substr. MG1655) is product of expression of dnaT gene.


DnaT is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: This protein is required for primosome-dependent normal DNA replication; it is also involved in inducing stable DNA replication during SOS response. It forms, in concert with dnaB protein and other prepriming proteins dnaC, N, N', N'' a prepriming protein complex on the specific site of the template DNA recognized by protein N'.

INTERACTION: Q9F505:yheB (xeno); NbExp=1; IntAct=EBI-549621, EBI-549635;

SIMILARITY: Belongs to the dnaT family.


NCBI GenPept GI number(s): 16132183
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A8J2 P0A8J2
PFAM: - P0A8J2 (Link - using uniprot id)
InterPro: - P0A8J2 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSSRVLTPDVVGIDALVHDHQTVLAKAEGGVVAVFANNAPAFYAVTPARL
AELLALEEKLARPGSDVALDDQLYQEPQAAPVAVPMGKFAMYPDWQPDAD
FIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQI
GRASNGGLPKRDVNTVSEPDSQIPPGFRG

References:

Title Authors Journal
Cloning of the Escherichia coli gene for primosomal protein i: the relationship to dnaT, essential for chromosomal DNA replication. Masai H, Bond MW, Arai K Proc Natl Acad Sci U S A March 1, 1986
Structure of Escherichia coli dnaC. Identification of a cysteine residue possibly involved in association with dnaB protein. Nakayama N, Bond MW, Miyajima A, Kobori J, Arai K J Biol Chem Aug. 5, 1987
Operon structure of dnaT and dnaC genes essential for normal and stable DNA replication of Escherichia coli chromosome. Masai H, Arai K J Biol Chem Oct. 15, 1988
Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR Nucleic Acids Res June 25, 1995
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 12, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.