Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecR

Protein FULL name:

gap repair protein [Escherichia coli str. K-12 substr. MG1655].


RecR (Escherichia coli strain K-12 substr. MG1655) is product of expression of recR gene.


RecR is involved in:

HRR in Escherichia coli strain K-12 substr. MG1655




FUNCTION: May play a role in DNA repair. It seems to be involved in an recBC-independent recombinational process of DNA repair. It may act with recF and recO.

SIMILARITY: Belongs to the recR family.

SIMILARITY: Contains 1 Toprim domain.


NCBI GenPept GI number(s): 16128456
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A7H6 P0A7H6
PFAM: - P0A7H6 (Link - using uniprot id)
InterPro: - P0A7H6 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRA
MSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQ
FSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEG
EATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIR
F

References:

Title Authors Journal
The recR locus of Escherichia coli K-12: molecular cloning, DNA sequencing and identification of the gene product. Mahdi AA, Lloyd RG Nucleic Acids Res Sept. 12, 1989
Sequence and expression of the Escherichia coli recR locus. Yeung T, Mullin DA, Chen KS, Craig EA, Bardwell JC, Walker JR J Bacteriol Oct. 1, 1990
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.