Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Xrs2p

Protein FULL name:

Protein required for DNA repair; component of the Mre11 complex, which is involved in double strand breaks, meiotic recombination, telomere maintenance, and checkpoint signaling (XRS2)


Xrs2p (Saccharomyces cerevisiae) is product of expression of XRS2 gene.


Xrs2p is involved in:

NHEJ in Saccharomyces cerevisiae

Keywords:



FUNCTION: During meiosis is involved in homologous recombination and during vegetative growth it is necessary for DNA repair. It probably regulates the 5'-3' exonuclease degradation of double strand breaks either at the initiation stage or a later stage.

INTERACTION: P38083:-; NbExp=1; IntAct=EBI-20599, EBI-21469;

MISCELLANEOUS: Present with 358 molecules/cell in log phase SD medium.


NCBI GenPept GI number(s): 296143718
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P33301 P33301
PFAM: - P33301 (Link - using uniprot id)
InterPro: - P33301 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQH
ITFKWEINNSSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKS
TIIELGTTPIRIEFEWINEVWNIPPHLTQFRTMLSEYGISTEISINDIPA
NLMISDYPKSEDNSIRELYALVSTIPMKKSRFLMELCNTLLPTSKTNLKF
DEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIKSEPRLSSLLR
TFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML
TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASP
VVSKKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESK
TVISSPNIAEADEKHAPFLQNALKPTEDIGKKSGHSSPGAIIVSSPNLGT
VNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDD
AEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIK
EKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIV
EPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKS
KAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENED
MFALTEMERFGSNTFMSDNINSNTIQKRSQALNRFTNEDSSNEGEEDSFS
FSRCSGTAASVQPLKNKIFITDEDDLGDIDDKSDRLNHRENNRNLFVVKE
MNLRPNLSEECSKQSRHSRSATSRSRGSFGASNNGDGDDDDDDGPKFTFK
RRKG

References:

Title Authors Journal
XRS2, a DNA repair gene of Saccharomyces cerevisiae, is needed for meiotic recombination. Ivanov EL, Korolev VG, Fabre F Genetics Nov. 1, 1992
Mutations in XRS2 and RAD50 delay but do not prevent mating-type switching in Saccharomyces cerevisiae. Ivanov EL, Sugawara N, White CI, Fabre F, Haber JE Mol Cell Biol May 1, 1994
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A June 19, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.