Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Xrs2p |
Protein FULL name:
Protein required for DNA repair; component of the Mre11 complex, which is involved in double strand breaks, meiotic recombination, telomere maintenance, and checkpoint signaling (XRS2)
Xrs2p (Saccharomyces cerevisiae) is product of expression of XRS2 gene.
Xrs2p is involved in:
NHEJ in Saccharomyces cerevisiae
- MRX complex joins the DNA/YKu70/80 complex in Saccharomyces cerevisiae
- Processing with polymerase 4 in Saccharomyces cerevisiae
- Gap filling and non-ligatable DNA ends processing in Saccharomyces cerevisiae
- Ligation of DNA strands by Dnl4/Lif1/Nej1 complex in Saccharomyces cerevisiae
Keywords:
FUNCTION: During meiosis is involved in homologous recombination and during vegetative growth it is necessary for DNA repair. It probably regulates the 5'-3' exonuclease degradation of double strand breaks either at the initiation stage or a later stage.
INTERACTION: P38083:-; NbExp=1; IntAct=EBI-20599, EBI-21469;
MISCELLANEOUS: Present with 358 molecules/cell in log phase SD medium.
| NCBI GenPept GI number(s): |
296143718 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P33301 |
P33301 |
| PFAM: | - |
P33301 (Link - using uniprot id) |
| InterPro: | - |
P33301 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQH ITFKWEINNSSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKS TIIELGTTPIRIEFEWINEVWNIPPHLTQFRTMLSEYGISTEISINDIPA NLMISDYPKSEDNSIRELYALVSTIPMKKSRFLMELCNTLLPTSKTNLKF DEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIKSEPRLSSLLR TFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASP VVSKKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESK TVISSPNIAEADEKHAPFLQNALKPTEDIGKKSGHSSPGAIIVSSPNLGT VNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDD AEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIK EKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIV EPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKS KAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENED MFALTEMERFGSNTFMSDNINSNTIQKRSQALNRFTNEDSSNEGEEDSFS FSRCSGTAASVQPLKNKIFITDEDDLGDIDDKSDRLNHRENNRNLFVVKE MNLRPNLSEECSKQSRHSRSATSRSRGSFGASNNGDGDDDDDDGPKFTFK RRKG |
References:
| Title | Authors | Journal |
| XRS2, a DNA repair gene of Saccharomyces cerevisiae, is needed for meiotic recombination. | Ivanov EL, Korolev VG, Fabre F | Genetics Nov. 1, 1992 |
| Mutations in XRS2 and RAD50 delay but do not prevent mating-type switching in Saccharomyces cerevisiae. | Ivanov EL, Sugawara N, White CI, Fabre F, Haber JE | Mol Cell Biol May 1, 1994 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. | Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. | Nature May 1, 1997 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|