Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Lif1p |
Protein FULL name:
Component of the DNA ligase IV complex that mediates nonhomologous end joining in DNA double-strand break repair; physically interacts with Dnl4p and Nej1p; homologous to mammalian XRCC4 protein (LIF1)
Lif1p (Saccharomyces cerevisiae) is product of expression of LIF1 gene.
Lif1p is involved in:
NHEJ in Saccharomyces cerevisiae
Keywords:
FUNCTION: Stabilizes DNL4. Involved in non-homologous repair of DNA double-strand breaks.
SUBUNIT: Interacts with the BRCT domain of DNL4 and with NEJ1. The DNL4-LIF1 complex interacts with POL4.
INTERACTION: P38799:-; NbExp=1; IntAct=EBI-23865, EBI-24593; Q08387:DNL4; NbExp=2; IntAct=EBI-23865, EBI-5983; Q06148:NEJ1; NbExp=2; IntAct=EBI-23865, EBI-34047;
SUBCELLULAR LOCATION: Cytoplasm. Nucleus.
MISCELLANEOUS: Present with 876 molecules/cell in log phase SD medium.
| NCBI GenPept GI number(s): |
296144956 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P53150 |
P53150 |
| PFAM: | - |
P53150 (Link - using uniprot id) |
| InterPro: | - |
P53150 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSQLTEFISCIPVVNEEQNEEDERGLCKIQIEDGAMLETLDENSLSGLRI EKMLVSEGTGIFSKSSFGINDLRIFTGENIDEESKKYVWYELLKMLTGHK VYIASLDEKVVFTKWTCRMQDDEVWKVVMELESSAIIRKIAELTLHPVKK GEIDLFEMADKLYKDICCVNDSYRNIKESDSSNRNRVEQLARERELLDKL LETRDERTRAMMVTLLNEKKKKIRELHEILRQNNIKLSDDDVLDSALINT EVQKPISELNSPGKRMKRRKTVVEPQNLQKKLKDTSRRRANRKISNQSVI KMEDDDFDDFQFFGLSKRPIITAKDKLSEKYDDITSFGDDTQSISFESDS SSDVQKHLVSLEDNGIQISAGRSDEDYGDISGSESETDASAGEKKSSNHS EQSGNDREPCLQTESETDIET |
References:
| Title | Authors | Journal |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. | Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K, et al. | Nature May 1, 1997 |
| Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII. | Rieger M, Bruckner M, Schafer M, Muller-Auer S | Yeast Sept. 15, 1997 |
| Saccharomyces cerevisiae LIF1: a function involved in DNA double-strand break repair related to mammalian XRCC4. | Herrmann G, Lindahl T, Schar P | EMBO J July 15, 1998 |
| NHEJ regulation by mating type is exercised through a novel protein, Lif2p, essential to the ligase IV pathway. | Frank-Vaillant M, Marcand S | Genes Dev Nov. 15, 2001 |
| A physical and functional interaction between yeast Pol4 and Dnl4-Lif1 links DNA synthesis and ligation in nonhomologous end joining. | Tseng HM, Tomkinson AE | J Biol Chem Nov. 22, 2002 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Global analysis of protein localization in budding yeast. | Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK | Nature Oct. 16, 2003 |
| Structure of an Xrcc4-DNA ligase IV yeast ortholog complex reveals a novel BRCT interaction mode. | Dore AS, Furnham N, Davies OR, Sibanda BL, Chirgadze DY, Jackson SP, Pellegrini L, Blundell TL | DNA Repair (Amst) March 7, 2006 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|