Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nej1p

Nej1p (Saccharomyces cerevisiae) is product of expression of NEJ1 gene.


Nej1p is involved in:

NHEJ in Saccharomyces cerevisiae




FUNCTION: Involved in non-homologous end joining (NHEJ). Facilitates the transport of LIF1 into the nucleus, where it can interact with DNA ligase DNL4 to repair double-strand breaks (DSB). Mediates mating-type regulation of NHEJ. Prevents chromosome circularisation by NHEJ in absence of telomerase.

INTERACTION: P53150:LIF1; NbExp=2; IntAct=EBI-34047, EBI-23865;

SUBCELLULAR LOCATION: Cytoplasm. Nucleus membrane; Multi-pass membrane protein.

INDUCTION: Repressed in diploid cells.

MISCELLANEOUS: Present with 377 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the XLF family.


NCBI GenPept GI number(s): 296146799
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q06148 Q06148
PFAM: - Q06148 (Link - using uniprot id)
InterPro: - Q06148 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDSELKGQQLSDAEWCVKKINGEGNCLLLFLPMSSPTTIVMIVLVSLERL
VPYVFKLSQTQLSQQCQSQGFTDSISLNLIKLKLMDILQAPQEINQIGLV
DSNLVFSFDVSADITVSINSVPSHVTKDMFYMILQSLCMLLLKLVNLSTQ
YHYVQRDILNEKQKCLDFLLISLRDLDGGSKVISQWAPENSKNYESLQQC
TDDDIIKKLLHKGKFQHQEFLADSLKTLLSLRNKFQDVSRFEESGELNKK
ERVRFPAVNHFYNDDFELQADPTNEARPNSRGKIKPKTDFKPKSRESSTS
SQLRLENFSESEATPEKTKSSSSLVEEYPQKKRKFGKVRIKN

References:

Title Authors Journal
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII. Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H, Dubois E, Dusterhoft A, Entian KD, Floeth M, Goffeau A, Hebling U, Heumann K, Heuss-Neitzel D, Hilbert H, Hilger F, Kleine K, Kotter P, Louis EJ, Messenguy F, Mewes HW, Hoheisel JD, et al. Nature May 1, 1997
Nej1p, a cell type-specific regulator of nonhomologous end joining in yeast. Kegel A, Sjostrand JO, Astrom SU Curr Biol Oct. 16, 2001
NHEJ regulation by mating type is exercised through a novel protein, Lif2p, essential to the ligase IV pathway. Frank-Vaillant M, Marcand S Genes Dev Nov. 15, 2001
NEJ1 controls non-homologous end joining in Saccharomyces cerevisiae. Valencia M, Bentele M, Vaze MB, Herrmann G, Kraus E, Lee SE, Schar P, Haber JE Nature Dec. 6, 2001
A DNA microarray-based genetic screen for nonhomologous end-joining mutants in Saccharomyces cerevisiae. Ooi SL, Shoemaker DD, Boeke JD Science Dec. 21, 2001
A genomics-based screen for yeast mutants with an altered recombination/end-joining repair ratio. Wilson TE Genetics Oct. 1, 2002
NEJ1 prevents NHEJ-dependent telomere fusions in yeast without telomerase. Liti G, Louis EJ Mol Cell May 1, 2003
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature Oct. 16, 2003
Mutations of the Yku80 C terminus and Xrs2 FHA domain specifically block yeast nonhomologous end joining. Palmbos PL, Daley JM, Wilson TE Mol Cell Biol Dec. 1, 2005
Sequence diversity, reproductive isolation and species concepts in Saccharomyces. Liti G, Barton DB, Louis EJ Genetics Oct. 1, 2006
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res April 1, 2007


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.