Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Tfb5p

Protein FULL name:

Component of the RNA polymerase II general transcription and DNA repair factor TFIIH; involved in transcription initiation and in nucleotide-excision repair; homolog of Chlamydomonas reinhardtii REX1-S protein involved in DNA repair


Tfb5p (Saccharomyces cerevisiae) is product of expression of TFB5 gene.






FUNCTION: Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro. TFB5 is required for stable recruitment of TFIIH to a promoter, but not for stability of TFIIH subunits.

SUBUNIT: Component of the TFIIH core complex, which is composed of RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.

SUBCELLULAR LOCATION: Nucleus.

SIMILARITY: Belongs to the TFB5 family.


This protein can be a part of a given complexes:
NCBI GenPept GI number(s): 13129164
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q3E7C1 Q3E7C1
PFAM: - Q3E7C1 (Link - using uniprot id)
InterPro: - Q3E7C1 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFV
KHELNRLLSKNIYNPMDEEENQ

References:

Title Authors Journal
RNA polymerase transcription factor IIH holoenzyme from yeast. Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD J Biol Chem Nov. 11, 1994
Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair. Sung P, Guzder SN, Prakash L, Prakash S J Biol Chem May 3, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature Oct. 16, 2003
Identification of TFB5, a new component of general transcription and DNA repair factor IIH. Ranish JA, Hahn S, Lu Y, Yi EC, Li XJ, Eng J, Aebersold R Nat Genet July 1, 2004


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.