Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Tfb5p |
Protein FULL name:
Component of the RNA polymerase II general transcription and DNA repair factor TFIIH; involved in transcription initiation and in nucleotide-excision repair; homolog of Chlamydomonas reinhardtii REX1-S protein involved in DNA repair
Tfb5p (Saccharomyces cerevisiae) is product of expression of TFB5 gene.
FUNCTION: Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro. TFB5 is required for stable recruitment of TFIIH to a promoter, but not for stability of TFIIH subunits.
SUBUNIT: Component of the TFIIH core complex, which is composed of RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.
SUBCELLULAR LOCATION: Nucleus.
SIMILARITY: Belongs to the TFB5 family.
This protein can be a part of a given complexes:
| NCBI GenPept GI number(s): |
13129164 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q3E7C1 |
Q3E7C1 |
| PFAM: | - |
Q3E7C1 (Link - using uniprot id) |
| InterPro: | - |
Q3E7C1 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFV KHELNRLLSKNIYNPMDEEENQ |
References:
| Title | Authors | Journal |
| RNA polymerase transcription factor IIH holoenzyme from yeast. | Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD | J Biol Chem Nov. 11, 1994 |
| Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair. | Sung P, Guzder SN, Prakash L, Prakash S | J Biol Chem May 3, 1996 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. | Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. | Nature May 1, 1997 |
| Global analysis of protein localization in budding yeast. | Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK | Nature Oct. 16, 2003 |
| Identification of TFB5, a new component of general transcription and DNA repair factor IIH. | Ranish JA, Hahn S, Lu Y, Yi EC, Li XJ, Eng J, Aebersold R | Nat Genet July 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|