Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad14p

Protein FULL name:

Protein that recognizes and binds damaged DNA during nucleotide excision repair; subunit of Nucleotide Excision Repair Factor 1 (NEF1); contains zinc finger motif; homolog of human XPA protein


Rad14p (Saccharomyces cerevisiae) is product of expression of RAD14 gene.


Rad14p is involved in:

NER in Saccharomyces cerevisiae




FUNCTION: Involved in nucleotide excision repair. Binds specifically to damaged DNA. Required for the incision step.

SUBUNIT: Component of the nucleotide excision repair factor 1 (NEF1) complex consisting of RAD1, RAD10 and RAD14.

INTERACTION: P06777:RAD1; NbExp=1; IntAct=EBI-14641, EBI-14752;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 1030 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the XPA family.


NCBI GenPept GI number(s): 6323857
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P28519 P28519
PFAM: - P28519 (Link - using uniprot id)
InterPro: - P28519 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MTPEQKAKLEANRKLAIERLRKRGILSSDQLNRIESRNEPLKTRPLAVTS
GSNRDDNAAAAVHVPNHNGQPSALANTNTNTTSLYGSGVVDGSKRDASVL
DKRPTDRIRPSIRKQDYIEYDFATMQNLNGGYINPKDKLPNSDFTDDQEF
ESEFGSKKQKTLQDWKKEQLERKMLYENAPPPEHISKAPKCIECHINIEM
DPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYFLTDPELNDEDLFH
RLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGLDEEWQRREEGKAH
RREKKYEKKIKEMRLKTRAQEYTNRLREKKHGKAHIHHFSDPVDGGIDED
GYQIQRRRCTDCGLETEEIDI

References:

Title Authors Journal
Yeast RAD14 and human xeroderma pigmentosum group A DNA-repair genes encode homologous proteins. Bankmann M, Prakash L, Prakash S Nature Jan. 6, 1992
Yeast DNA-repair gene RAD14 encodes a zinc metalloprotein with affinity for ultraviolet-damaged DNA. Guzder SN, Sung P, Prakash L, Prakash S Proc Natl Acad Sci U S A June 15, 1993
Nucleotide excision repair in yeast is mediated by sequential assembly of repair factors and not by a pre-assembled repairosome. Guzder SN, Sung P, Prakash L, Prakash S J Biol Chem April 12, 1996
Characterization of the rad14-2 mutant of Saccharomyces cerevisiae: implications for the recognition of UV photoproducts by the Rad14 protein. Jones GW, Reed SH, Waters R Yeast Feb. 1, 1997
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.