Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Rad14p |
Protein FULL name:
Protein that recognizes and binds damaged DNA during nucleotide excision repair; subunit of Nucleotide Excision Repair Factor 1 (NEF1); contains zinc finger motif; homolog of human XPA protein
Rad14p (Saccharomyces cerevisiae) is product of expression of RAD14 gene.
Rad14p is involved in:
NER in Saccharomyces cerevisiae
- recruitment of TFIIH and Rad14 in Saccharomyces cerevisiae
- Rad25 and Rad3 unwind DNA in presence of RNAP in Saccharomyces cerevisiae
- RPA binds to undamaged strand in Saccharomyces cerevisiae
- Rad2 joins the complex in Saccharomyces cerevisiae
- recruitment of Rad1/Rad10 complex in Saccharomyces cerevisiae
- RNAP dissociates in Saccharomyces cerevisiae
- ubiquitination of Rad26 in Saccharomyces cerevisiae
- Removal of the damaged strand fragment in Saccharomyces cerevisiae
- removal of fragment of damaged strand in Saccharomyces cerevisiae
- Rad14 recruits Rad1/Rad10 complex in Saccharomyces cerevisiae
- XPC complex dissotiates in Saccharomyces cerevisiae
- Rad14 joins the complex in Saccharomyces cerevisiae
- Rad25 and Rad3 unwind DNA in Saccharomyces cerevisiae
FUNCTION: Involved in nucleotide excision repair. Binds specifically to damaged DNA. Required for the incision step.
SUBUNIT: Component of the nucleotide excision repair factor 1 (NEF1) complex consisting of RAD1, RAD10 and RAD14.
INTERACTION: P06777:RAD1; NbExp=1; IntAct=EBI-14641, EBI-14752;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: Present with 1030 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the XPA family.
| NCBI GenPept GI number(s): |
6323857 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P28519 |
P28519 |
| PFAM: | - |
P28519 (Link - using uniprot id) |
| InterPro: | - |
P28519 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MTPEQKAKLEANRKLAIERLRKRGILSSDQLNRIESRNEPLKTRPLAVTS GSNRDDNAAAAVHVPNHNGQPSALANTNTNTTSLYGSGVVDGSKRDASVL DKRPTDRIRPSIRKQDYIEYDFATMQNLNGGYINPKDKLPNSDFTDDQEF ESEFGSKKQKTLQDWKKEQLERKMLYENAPPPEHISKAPKCIECHINIEM DPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYFLTDPELNDEDLFH RLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGLDEEWQRREEGKAH RREKKYEKKIKEMRLKTRAQEYTNRLREKKHGKAHIHHFSDPVDGGIDED GYQIQRRRCTDCGLETEEIDI |
References:
| Title | Authors | Journal |
| Yeast RAD14 and human xeroderma pigmentosum group A DNA-repair genes encode homologous proteins. | Bankmann M, Prakash L, Prakash S | Nature Jan. 6, 1992 |
| Yeast DNA-repair gene RAD14 encodes a zinc metalloprotein with affinity for ultraviolet-damaged DNA. | Guzder SN, Sung P, Prakash L, Prakash S | Proc Natl Acad Sci U S A June 15, 1993 |
| Nucleotide excision repair in yeast is mediated by sequential assembly of repair factors and not by a pre-assembled repairosome. | Guzder SN, Sung P, Prakash L, Prakash S | J Biol Chem April 12, 1996 |
| Characterization of the rad14-2 mutant of Saccharomyces cerevisiae: implications for the recognition of UV photoproducts by the Rad14 protein. | Jones GW, Reed SH, Waters R | Yeast Feb. 1, 1997 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. | Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B | Nature May 1, 1997 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|