Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad2p

Rad2p (Saccharomyces cerevisiae) is product of expression of RAD2 gene.


Rad2p is involved in:

NER in Saccharomyces cerevisiae




FUNCTION: Single-stranded DNA endonuclease involved in excision repair of DNA damaged with UV light, bulky adducts, or cross- linking agents. Essential for the incision step of excision- repair.

COFACTOR: Binds 2 magnesium ions per subunit. They probably participate in the reaction catalyzed by the enzyme. May bind an additional third magnesium ion after substrate binding (By similarity).

INTERACTION: Q08215:PEX15; NbExp=1; IntAct=EBI-14757, EBI-31849;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 846 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the XPG/RAD2 endonuclease family. XPG subfamily.


NCBI GenPept GI number(s): 6321697
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P07276 P07276
PFAM: - P07276 (Link - using uniprot id)
InterPro: - P07276 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MGVHSFWDIAGPTARPVRLESLEDKRMAVDASIWIYQFLKAVRDQEGNAV
KNSHITGFFRRICKLLYFGIRPVFVFDGGVPVLKRETIRQRKERRQGKRE
SAKSTARKLLALQLQNGSNDNVKNSTPSSGSSVQIFKPQDEWDLPDIPGF
KYDKEDARVNSNKTFEKLMNSINGDGLEDIDLDTINPASAEFEELPKATQ
YLILSSLRLKSRLRMGYSKEQLETIFPNSMDFSRFQIDMVKRRNFFTQKL
INTTGFQDGGASKLNEEVINRISGQKSKEYKLTKTNNGWILGLGANDGSD
AQKAIVIDDKDAGALVKQLDSNAEDGDVLRWDDLEDNSLKIVRHESSNAT
TAPQKRSNRSEDEGCDSDECEWEEVELKPKNVKFVEDFSLKAARLPYMGQ
SLNNAGSKSFLDKRHDQASPSKTTPTMRISRISVEDDDEDYLKQIEEIEM
MEAVQLSKMEKKPEADDKSKIAKPVTSKGTEARPPIVQYGLLGAQPDSKQ
PYHVTNLNSKSESVIKRTSKTVLSEFRPPSQQEDKGAILTEGEQNLNFIS
HKIPQFDFNNENSLLFQKNTESNVSQEATKEKSPIPEMPSWFSSTASQQL
YNPYNTTNFVEDKNVRNEQESGAETTNKGSSYELLTGLNATEILERESEK
ESSNDENKDDDLEVLSEELFEDVPTKSQISKEAEDNDSRKVESINKEHRK
PLIFDYDFSEDEEDNIVENMIKEQEEFDTFKNTTLSTSAERNVAENAFVE
DELFEQQMKDKRDSDEVTMDMIKEVQELLSRFGIPYITAPMEAEAQCAEL
LQLNLVDGIITDDSDVFLFGGTKIYKNMFHEKNYVEFYDAESILKLLGLD
RKNMIELAQLLGSDYTNGLKGMGPVSSIEVIAEFGNLKNFKDWYNNGQFD
KRKQETENKFEKDLRKKLVNNEIILDDDFPSVMVYDAYMRPEVDHDTTPF
VWGVPDLDMLRSFMKTQLGWPHEKSDEILIPLIRDVNKRKKKGKQKRINE
FFPREYISGDKKLNTSKRISTATGKLKKRKM

References:

Title Authors Journal
The RAD2 gene of Saccharomyces cerevisiae: nucleotide sequence and transcript mapping. Nicolet CM, Chenevert JM, Friedberg EC Gene Jan. 1, 1985
Nucleotide sequence, transcript mapping, and regulation of the RAD2 gene of Saccharomyces cerevisiae. Madura K, Prakash S J Bacteriol June 1, 1986
Yeast excision repair gene RAD2 encodes a single-stranded DNA endonuclease. Habraken Y, Sung P, Prakash L, Prakash S Nature Nov. 25, 1993
Analysis of an 11.6 kb region from the right arm of chromosome VII of Saccharomyces cerevisiae between the RAD2 and the MES1 genes reveals the presence of three new genes. Clemente ML, Sartori G, Cardazzo B, Carignani G Yeast March 15, 1997
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K, et al. Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.