Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Dam

Protein FULL name:

DNA adenine methylase [Escherichia coli str. K-12 substr. MG1655].


Dam (Escherichia coli strain K-12 substr. MG1655) is product of expression of dam gene.


Dam is involved in:

MMR in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Methylates DNA within the sequence GATC and protects the DNA from cleavage by the restriction endonuclease MboI. Although it shares sequence specificity with a number of type II restriction endonucleases and methylases, it is thought to act in postreplication mismatch repair rather than as a part of a restriction modification system. May also play a role in DNA replication.

CATALYTIC ACTIVITY: S-adenosyl-L-methionine + DNA adenine = S- adenosyl-L-homocysteine + DNA 6-methylaminopurine.

SIMILARITY: Belongs to the N(4)/N(6)-methyltransferase family.


NCBI GenPept GI number(s): 16131265
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0AEE8 P0AEE8
PFAM: - P0AEE8 (Link - using uniprot id)
InterPro: - P0AEE8 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRY
ILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNK
SQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYH
FAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNS
FTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRS
ISSNGGTRKKVDELLALYKPGVVSPAKK

References:

Title Authors Journal
The isolation and characterization of the Escherichia coli DNA adenine methylase (dam) gene. Brooks JE, Blumenthal RM, Gingeras TR Nucleic Acids Res Jan. 11, 1983
The Escherichia coli dam gene is expressed as a distal gene of a new operon. Jonczyk P, Hines R, Smith DW Mol Gen Genet May 1, 1989
The role of the preserved sequences of Dam methylase. Guyot JB, Grassi J, Hahn U, Guschlbauer W Nucleic Acids Res July 11, 1993
Characterization of three genes in the dam-containing operon of Escherichia coli. Lyngstadaas A, Lobner-Olesen A, Boye E Mol Gen Genet June 10, 1995
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 12, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.