Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

DinB

Protein FULL name:

DNA polymerase IV


Protein SHORT name:

DinB, DinP


DinB (Escherichia coli strain K-12 substr. MG1655) is product of expression of dinB gene.


DinB is involved in:

TLS in Escherichia coli strain K-12 substr. MG1655
     
DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by polIV. Exhibits no 3'-5' exonuclease (proofreading) activity. Overexpression of polIV results in increased frameshift mutagenesis. It is required for stationary-phase adaptive mutation, which provides the bacterium with flexibility in dealing with environmental stress, enhancing long-term survival and evolutionary fitness. May be involved in translesional synthesis, in conjunction with the beta clamp from polIII.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

COFACTOR: Binds 2 magnesium ions per subunit (By similarity).

SUBUNIT: Monomer (Potential).

SUBCELLULAR LOCATION: Cytoplasm (Probable).

INDUCTION: By SOS response.

DOMAIN: The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity. It lacks the O helices present in high-fidelity DNA polymerases in the fingers domain (By similarity).

SIMILARITY: Belongs to the DNA polymerase type-Y family.

SIMILARITY: Contains 1 umuC domain.


NCBI GenPept GI number(s): 16128217
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot Q47155 Q47155
PFAM: - Q47155 (Link - using uniprot id)
InterPro: - Q47155 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARK
FGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPL
SLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAK
IASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTC
GDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMA
EDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ
EHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLG
L


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.