Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

XseB

Protein FULL name:

exonuclease VII small subunit [Escherichia coli str. K-12 substr. W3110].


XseB (Escherichia coli strain K-12 substr. MG1655) is product of expression of xseB gene.






FUNCTION: Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. It can also degrade 3' or 5' ss regions extending from the termini of duplex DNA molecules and displaced ss regions.

CATALYTIC ACTIVITY: Exonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield nucleoside 5'-phosphates.

SUBUNIT: Heterooligomer composed of two different subunits with an approximate ratio of 4 small subunits for 1 large.

SUBCELLULAR LOCATION: Cytoplasm.

SIMILARITY: Belongs to the xseB family.


NCBI GenPept GI number(s): 89107292
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A8G9 P0A8G9
PFAM: - P0A8G9 (Link - using uniprot id)
InterPro: - P0A8G9 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQ
AKLQQAEQRVQILLSDNEDASLTPFTPDNE


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.