Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

SulA

Protein FULL name:

SOS cell division inhibitor [Escherichia coli str. K-12 substr. W3110].


SulA (Escherichia coli strain K-12 substr. MG1655) is product of expression of sulA gene.


SulA is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Component of the SOS system and an inhibitor of cell division. Accumulation of sulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. In the presence of GTP, binds a polymerization-competent form of ftsZ in a 1:1 ratio, thus inhibiting ftsZ polymerization and therefore preventing it from participating in the assembly of the Z ring. This mechanism prevents the premature segregation of damaged DNA to daughter cells during cell division.

SUBUNIT: Interacts with ftsZ.

INDUCTION: By DNA damage, as part of the SOS response. Repressed by lexA.

PTM: Is rapidly cleaved and degraded by the lon protease once DNA damage is repaired.

SIMILARITY: Belongs to the sulA family.

SEQUENCE CAUTION: Sequence=CAA23587.1; Type=Frameshift; Positions=145;


NCBI GenPept GI number(s): 89107808
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0AFZ5 P0AFZ5
PFAM: - P0AFZ5 (Link - using uniprot id)
InterPro: - P0AFZ5 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MYTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLL
LPLLQQLGQQSRWQLWLTPQQKLSREWVQASGLPLTKVMQISQLSPCHTV
ESMVRALRTGNYSVVIGWLADDLTEEEHAELVDAANEGNAMGFIMRPVSA
SSHATRQLSGLKIHSNLYH

References:

Title Authors Journal
Nucleotide sequence of the gene ompA coding the outer membrane protein II of Escherichia coli K-12. Beck E, Bremer E Nucleic Acids Res July 11, 1980
Characterisation of the promoter for the LexA regulated sulA gene of Escherichia coli. Cole ST Mol Gen Genet Jan. 1, 1983
Protein degradation in Escherichia coli: the lon gene controls the stability of sulA protein. Mizusawa S, Gottesman S Proc Natl Acad Sci U S A Feb. 1, 1983
Cell-division control in Escherichia coli: specific induction of the SOS function SfiA protein is sufficient to block septation. Huisman O, D'Ari R, Gottesman S Proc Natl Acad Sci U S A July 1, 1984
Role of the SulB (FtsZ) protein in division inhibition during the SOS response in Escherichia coli: FtsZ stabilizes the inhibitor SulA in maxicells. Jones C, Holland IB Proc Natl Acad Sci U S A Sept. 1, 1985
Evolution of the enterobacterial sulA gene: a component of the SOS system encoding an inhibitor of cell division. Freudl R, Braun G, Honore N, Cole ST Gene Jan. 1, 1987
Analysis of ftsZ mutations that confer resistance to the cell division inhibitor SulA (SfiA). Bi E, Lutkenhaus J J Bacteriol Oct. 1, 1990
Cell division inhibitors SulA and MinCD prevent formation of the FtsZ ring. Bi E, Lutkenhaus J J Bacteriol Jan. 1, 1993
A cell division inhibitor SulA of Escherichia coli directly interacts with FtsZ through GTP hydrolysis. Higashitani A, Higashitani N, Horiuchi K Biochem Biophys Res Commun April 6, 1995
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res June 1, 1996
Interaction between FtsZ and inhibitors of cell division. Huang J, Cao C, Lutkenhaus J J Bacteriol Sept. 1, 1996
Functional dissection of a cell-division inhibitor, SulA, of Escherichia coli and its negative regulation by Lon. Higashitani A, Ishii Y, Kato Y, Koriuchi K Mol Gen Genet April 28, 1997
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Inhibition of FtsZ polymerization by SulA, an inhibitor of septation in Escherichia coli. Mukherjee A, Cao C, Lutkenhaus J Proc Natl Acad Sci U S A March 17, 1998
Bacterial SOS checkpoint protein SulA inhibits polymerization of purified FtsZ cell division protein. Trusca D, Scott S, Thompson C, Bramhill D J Bacteriol Aug. 1, 1998
Regulatory role of C-terminal residues of SulA in its degradation by Lon protease in Escherichia coli. Ishii Y, Sonezaki S, Iwasaki Y, Miyata Y, Akita K, Kato Y, Amano F J Biochem May 1, 2000
Cell division inhibitors SulA and MinC/MinD block septum formation at different steps in the assembly of the Escherichia coli division machinery. Justice SS, Garcia-Lara J, Rothfield LI Mol Microbiol July 1, 2000
Regulation of SulA cleavage by Lon protease by the C-terminal amino acid of SulA, histidine. Ishii Y, Amano F Biochem J Sept. 1, 2001
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006
Investigation of regulation of FtsZ assembly by SulA and development of a model for FtsZ polymerization. Dajkovic A, Mukherjee A, Lutkenhaus J J Bacteriol April 1, 2008


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.