Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

DinG

Protein FULL name:

ATP-dependent DNA helicase [Escherichia coli str. K-12 substr. W3110].


DinG (Escherichia coli strain K-12 substr. MG1655) is product of expression of dinG gene.


DinG is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: Probable helicase involved in DNA repair and perhaps also replication.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

SIMILARITY: Belongs to the helicase family. DinG subfamily.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SEQUENCE CAUTION: Sequence=AAA23685.1; Type=Erroneous initiation;


NCBI GenPept GI number(s): 89107650
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P27296 P27296
PFAM: - P27296 (Link - using uniprot id)
InterPro: - P27296 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MALTAALKAQIAAWYKALQEQIPDFIPRAPQRQMIADVAKTLAGEEGRHL
AIEAPTGVGKTLSYLIPGIAIAREEQKTLVVSTANVALQDQIYSKDLPLL
KKIIPDLKFTAAFGRGRYVCPRNLTALASTEPTQQDLLAFLDDELTPNNQ
EEQKRCAKLKGDLDTYKWDGLRDHTDIAIDDDLWRRLSTDKASCLNRNCY
YYRECPFFVARREIQEAEVVVANHALVMAAMESEAVLPDPKNLLLVLDEG
HHLPDVARDALEMSAEITAPWYRLQLDLFTKLVATCMEQFRPKTIPPLAI
PERLNAHCEELYELIASLNNILNLYMPAGQEAEHRFAMGELPDEVLEICQ
RLAKLTEMLRGLAELFLNDLSEKTGSHDIVRLHRLILQMNRALGMFEAQS
KLWRLASLAQSSGAPVTKWATREEREGQLHLWFHCVGIRVSDQLERLLWR
SIPHIIVTSATLRSLNSFSRLQEMSGLKEKAGDRFVALDSPFNHCEQGKI
VIPRMRVEPSIDNEEQHIAEMAAFFRKQVESKKHLGMLVLFASGRAMQRF
LDYVTDLRLMLLVQGDQPRYRLVELHRKRVANGERSVLVGLQSFAEGLDL
KGDLLSQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNL
IQQVGRLIRSHGCWGEVVIYDKRLLTKNYGKRLLDALPVFPIEQPEVPEG
IVKKKEKTKSPRRRRR

References:

Title Authors Journal
Interaction of LexA repressor with the asymmetric dinG operator and complete nucleotide sequence of the gene. Lewis LK, Mount DW J Bacteriol Aug. 1, 1992
Escherichia coli dinG gene encodes a putative DNA helicase related to a group of eukaryotic helicases including Rad3 protein. Koonin EV Nucleic Acids Res March 25, 1993
Structural analysis of the rhlE gene of Escherichia coli. Ohmori H Jpn J Genet Jan. 1, 1994
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res June 1, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 12, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.