Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

DinJ

Protein FULL name:

predicted antitoxin of YafQ-DinJ toxin-antitoxin system [Escherichia coli str. K-12 substr. W3110].


DinJ (Escherichia coli strain K-12 substr. MG1655) is product of expression of dinJ gene.


DinJ is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     


Keywords:


NCBI GenPept GI number(s): 89107101
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot Q47150 Q47150
PFAM: - Q47150 (Link - using uniprot id)
InterPro: - Q47150 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFD
LREPNQLTIQSIKNSEAGIDVHKAKDADDLFDKLGI

References:

Title Authors Journal
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.