Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
DinJ |
Protein FULL name:
predicted antitoxin of YafQ-DinJ toxin-antitoxin system [Escherichia coli str. K-12 substr. W3110].
DinJ (Escherichia coli strain K-12 substr. MG1655) is product of expression of dinJ gene.
DinJ is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
Keywords:
| NCBI GenPept GI number(s): |
89107101 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q47150 |
Q47150 |
| PFAM: | - |
Q47150 (Link - using uniprot id) |
| InterPro: | - |
Q47150 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFD LREPNQLTIQSIKNSEAGIDVHKAKDADDLFDKLGI |
References:
| Title | Authors | Journal |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|