Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

catalase





NCBI GenPept GI number(s): -

Links to other databases:

Database ID Link
Uniprot W5S153_9LAMI W5S153_9LAMI
PFAM: PF00199
PF00199
InterPro: - W5S153_9LAMI (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
>TR|WS|WS_LAMICATALASE(FRAGMENT)OS=PLECTRANTHUSBAR
BATUSGN=CATPE=SV=PILLEDYHLVEKLANFDRERIPERVVHARGASA
KGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG
FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR
ILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKVHY
VKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLFI
QIIDPDHEDKFDFDPLDVTKTWPEDVLPLQPVGRLVLNRNIDNFFAENEQ
LAFCPAIIVPGIYYSD

Catalase is able to recognize following damages:
Catalase belongs to following protein families:

Last modification of this entry: Jan. 5, 2016.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.