|
|
Protein FULL name: DNA polymerase III, Hys2p, Pol31p
Protein SHORT name: POL31, HUS2, HYS2, SDP5
Pol delta (Saccharomyces cerevisiae) is product of expression of
POL31
gene.
Pol delta is involved in:
BER in Saccharomyces cerevisiae
MMR in Saccharomyces cerevisiae
NER in Saccharomyces cerevisiae
Keywords:
FUNCTION: DNA polymerase delta (DNA polymerase III) participates
in chromosomal DNA replication. It is required during synthesis of
the leading and lagging DNA strands at the replication fork and
binds at/or near replication origins and moves along DNA with the
replication fork. It has 3'-5' proofreading exonuclease activity
that correct errors arising during DNA replication. It is also
involved in DNA synthesis during DNA repair.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) =
diphosphate + DNA(n+1).
SUBUNIT: DNA polymerase delta is a heterotrimer of POL3, POL32 and
HYS2.
INTERACTION:
P15436:POL3; NbExp=2; IntAct=EBI-6080, EBI-6134;
SUBCELLULAR LOCATION: Nucleus (By similarity).
MISCELLANEOUS: Present with 626 molecules/cell in log phase SD
medium.
SIMILARITY: Belongs to the DNA polymerase delta/II small subunit
family.
Links to other databases:
Protein sequence:
MDALLTKFNEDRSLQDENLSQPRTRVRIVDDNLYNKSNPFQLCYKKRDYG
SQYYHIYQYRLKTFRERVLKECDKRWDAGFTLNGQLVLKKDKVLDIQGNQ
PCWCVGSIYCEMKYKPNVLDEVINDTYGAPDLTKSYTDKEGGSDEIMLED
ESGRVHLVGDFIRSTPFITGVVVGILGMEAEAGTFQVLDICYPTPLPQNP
FPAPIATCPTRGKIALVSGLNLNNTSPDRLLRLEILREFLMGRINNKIDD
ISLIGRLLICGNSVDFDIKSVNKDELMISLTEFSKFLHNILPSISVDIMP
GTNDPSDKSLPQQPFHKSLFDKSLESYFNGSNKEILNLVTNPYEFSYNGV
DVLAVSGKNINDICKYVIPSNDNGESENKVEEGESNDFKDDIEHRLDLME
CTMKWQNIAPTAPDTLWCYPYTDKDPFVLDKWPHVYIVANQPYFGTRVVE
IGGKNIKIISVPEFNSTGMIILLDLETLEAETVKIDI
|
References:
|
Title
|
Authors
|
Journal
|
|
HYS2, an essential gene required for DNA replication in Saccharomyces cerevisiae.
|
Sugimoto K, Sakamoto Y, Takahashi O, Matsumoto K
|
Nucleic Acids Res
Sept. 11, 1995
|
|
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X.
|
Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, De Haan M, Domdey H, Durand P, Entian KD, Gatius M, Goffeau A, Grivell LA, Hennemann A, Herbert CJ, Heumann K, Hilger F, Hollenberg CP, Huang ME, Jacq C, Jauniaux JC, Katsoulou C, Karpfinger-Hartl L, et al.
|
EMBO J
May 1, 1996
|
|
The second subunit of DNA polymerase III (delta) is encoded by the HYS2 gene in Saccharomyces cerevisiae.
|
Hashimoto K, Nakashima N, Ohara T, Maki S, Sugino A
|
Nucleic Acids Res
Feb. 15, 1998
|
|
Characterization of the two small subunits of Saccharomyces cerevisiae DNA polymerase delta.
|
Gerik KJ, Li X, Pautz A, Burgers PM
|
J Biol Chem
July 31, 1998
|
|
Structure of DNA polymerase delta from Saccharomyces cerevisiae.
|
Johansson E, Majka J, Burgers PM
|
J Biol Chem
Nov. 23, 2001
|
|
Global analysis of protein expression in yeast.
|
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
|
Nature
Oct. 16, 2003
|
|
A multidimensional chromatography technology for in-depth phosphoproteome analysis.
|
Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H
|
Mol Cell Proteomics
July 1, 2008
|
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|